KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g171986Help
Entry
NEMVE_v1g171986   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:nve00562]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:nve00920]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:nve04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 320 aa AA seqDB search
MMGLSAKIRLSPIGFIVVGLCGLALVYYLTTDGNETGHSGESVSIKQLLAASIQLAEDGG
IAVRTVREQNNLSEKSKGKTKEGVNDPVTQGDLQSHRAMFYGFRKAFPSVKVLSSATILL
NNELQNIEDEYVPVSNVLVWIDPLDATKEYTENLLHFVTTMVCIVVNGKPVAGVIHKPFQ
KKSFWAWNGHGSSSNLNSKESVTKSDMSSPRIIISRSHAGKVNATARKAFGGKAVVIPAG
GAGYKVLSLFDGSADAYVHVTKIKKWDICAGDAILRALGGRMTTLKGDDIIYTDPSKPAN
DQGLLAALRNHKEFRRMLKL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatggggctttcggccaaaatccgcctttcccctattggatttatcgtggttggactt
tgtggtttggctctagtctattatttgactacggacgggaatgaaacaggccatagcggc
gaatcggtgtccataaaacagcttttagccgcatcgatacaacttgccgaagatggagga
atcgctgttcgaactgttcgcgaacaaaacaatctttcggaaaaaagtaagggaaaaaca
aaggagggtgtgaatgaccctgtcactcagggagacctccagtctcacagagccatgttt
tatggcttcagaaaagcctttccctccgtgaaagttctttcctcggccacaatattacta
aacaatgaacttcaaaatattgaagatgagtatgtcccagtgagtaatgtcttggtgtgg
attgacccacttgatgcaactaaagaatacactgaaaatcttcttcactttgttaccaca
atggtctgtatagttgttaatggcaagccagtggctggtgttatacacaagccctttcaa
aagaaatctttctgggcctggaatggtcatggtagctcttcaaacctgaactctaaagag
tctgttacaaagtctgacatgagctcaccaaggataataatatccagatctcatgcagga
aaggtgaatgctacggctaggaaagcatttggtggaaaggccgttgttatccctgcagga
ggtgcagggtacaaggtgctctctctgtttgacggcagtgcagatgcatatgtccatgtg
actaagatcaagaagtgggatatatgtgctggagatgcgatcttgagggctctaggtggt
agaatgacaacacttaaaggagacgatataatatatacagacccttcaaagcctgcaaat
gaccaagggttattggccgcattacgaaatcacaaagaatttagaagaatgttgaaactg
tag

DBGET integrated database retrieval system