KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g171986Help
Entry
NEMVE_v1g171986   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    NEMVE_v1g171986
  Energy metabolism
   00920 Sulfur metabolism
    NEMVE_v1g171986
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    NEMVE_v1g171986
Enzymes [BR:nve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     NEMVE_v1g171986
    3.1.3.25  inositol-phosphate phosphatase
     NEMVE_v1g171986
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 320 aa AA seqDB search
MMGLSAKIRLSPIGFIVVGLCGLALVYYLTTDGNETGHSGESVSIKQLLAASIQLAEDGG
IAVRTVREQNNLSEKSKGKTKEGVNDPVTQGDLQSHRAMFYGFRKAFPSVKVLSSATILL
NNELQNIEDEYVPVSNVLVWIDPLDATKEYTENLLHFVTTMVCIVVNGKPVAGVIHKPFQ
KKSFWAWNGHGSSSNLNSKESVTKSDMSSPRIIISRSHAGKVNATARKAFGGKAVVIPAG
GAGYKVLSLFDGSADAYVHVTKIKKWDICAGDAILRALGGRMTTLKGDDIIYTDPSKPAN
DQGLLAALRNHKEFRRMLKL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatggggctttcggccaaaatccgcctttcccctattggatttatcgtggttggactt
tgtggtttggctctagtctattatttgactacggacgggaatgaaacaggccatagcggc
gaatcggtgtccataaaacagcttttagccgcatcgatacaacttgccgaagatggagga
atcgctgttcgaactgttcgcgaacaaaacaatctttcggaaaaaagtaagggaaaaaca
aaggagggtgtgaatgaccctgtcactcagggagacctccagtctcacagagccatgttt
tatggcttcagaaaagcctttccctccgtgaaagttctttcctcggccacaatattacta
aacaatgaacttcaaaatattgaagatgagtatgtcccagtgagtaatgtcttggtgtgg
attgacccacttgatgcaactaaagaatacactgaaaatcttcttcactttgttaccaca
atggtctgtatagttgttaatggcaagccagtggctggtgttatacacaagccctttcaa
aagaaatctttctgggcctggaatggtcatggtagctcttcaaacctgaactctaaagag
tctgttacaaagtctgacatgagctcaccaaggataataatatccagatctcatgcagga
aaggtgaatgctacggctaggaaagcatttggtggaaaggccgttgttatccctgcagga
ggtgcagggtacaaggtgctctctctgtttgacggcagtgcagatgcatatgtccatgtg
actaagatcaagaagtgggatatatgtgctggagatgcgatcttgagggctctaggtggt
agaatgacaacacttaaaggagacgatataatatatacagacccttcaaagcctgcaaat
gaccaagggttattggccgcattacgaaatcacaaagaatttagaagaatgttgaaactg
tag

DBGET integrated database retrieval system