KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g172482Help
Entry
NEMVE_v1g172482   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:nve00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    NEMVE_v1g172482
Enzymes [BR:nve01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     NEMVE_v1g172482
Peptidases [BR:nve01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NEMVE_v1g172482
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1082 aa AA seqDB search
MMNTDGNGSDPEDMDTKEDVGSDTTMATNGSNSPKQADDVAMEEDTARPEGTIRFTLPNF
SKMDKTILSDPIYVRNLPWRIMLMPRYSSHGHERVKSLGFFLQCNPETETLSWSCQASAR
LTLVSQKEGVEDFSRKISHLFFAKENDWGFSHFVAWSDVLDPSKGYISKDSITVEVYVSA
DAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLYFTCALRKAVYQMPTENDDLGKSVA
FALQRVFYELQHSDKAVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNMESKMKGTCVE
GTIPRLLEGKLFSYIKCTKVDYVSTRLEPFYDIQLNVKGKKNIHDSFKEYCASELLDGDN
KYDAGEHGLQEAKKGVMFKKFPPVLHLQLMRFQYDPVADANVKINDRYEFYDKIDLDRYL
QELEDTPAVYTLHAVLVHSGDNHGGHYVVYINPKGDGRWCKFDDDVVSLATKQEAIDNNF
GGYEDDVTVKHCTNAYMLVYIRDSHINEILEEVTNNEIPDTLVSRLQEERRLEVQRRKER
TEAHLYITVEVVTEDQFCGHHGSDLFDFEKVKTKHFKVLKSLKMQEVLQVLADGIGYPVD
QIRPWPLQQRSNGTTRPAVFDMESDIDKPIGQLVDASSWVIFLETVDPENGTAPLPSYDK
KGDVLLFFKYYDPAQRVLALVGHLYVPLVTKFSELMPYLCEKAGLPQGTPLFMFEEVKIN
YAEQIRDTSLTIEHGVEELMDGDIICYQRSDNELLETSELPTVIEYFRDLHHRVEVLFCN
KNQPDDPGFTVVLSQRMNYTQVAKAVATHLEVDPMKLQFFKGQIYRDAPGNALRCTFEGT
LRDLLIYYKPRGPKKLFYQILSIPINQLENKRQFKCIWLNDSKEEQELVLWPNKEATVGD
LLEEAKSHVDCTSTGKLRLLEIISAKVFNTINNDVPLEHLVSQGQRIFRIEEIPSDEIDL
KTDEILIPVAHFNKEVYQTFGTPFLVRVSDGESISNLRDRVKAKVDIIDKEFDKIKLAIV
HMGRVNYLPDELDKVISIKDFQPQITTNSQQIGKPWLGLDHVNKAPKRTRYNYLERPIKI
HN
NT seq 3249 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacacagatggaaacggtagtgatccagaggatatggacaccaaagaagatgtt
ggaagtgatacgacgatggccacgaacggctctaactcacccaaacaagcggatgatgtt
gcgatggaggaggataccgccagacccgaagggacaattcgtttcactcttccaaacttt
agcaaaatggataagacaattttgagtgatcccatttacgtgagaaatttgccctggcgt
ataatgttgatgccgaggtactcttcacatggacacgagcgggttaaaagcctgggtttc
ttcttgcagtgcaacccagagacagagaccttgtcatggtcatgccaggcatctgctcga
cttactcttgtcagtcagaaagaaggagtggaggacttttccaggaaaatttcccatctc
ttctttgccaaggagaatgactggggatttagtcatttcgttgcttggagtgatgttctt
gaccccagtaagggctatatctctaaggactccatcacagtagaggtgtatgtttcagct
gatgcaccacatggtgtcgcttgggattccaaaaagcatacaggatatgttggtctgaaa
aaccagggtgcaacatgctacatgaattccctgctgcaaaccctgtacttcacctgtgcg
ctacgcaaggcggtgtaccaaatgcctactgagaatgatgaccttggaaaaagtgttgca
tttgctttgcaaagagttttctatgaactgcagcacagtgataaagcagttggcaccaag
aagcttacaaagtcttttggttgggaaacactggacagcttcatgcaacatgatgtacaa
gagctgtgtcgggtgttacttgacaatatggagagcaaaatgaaaggaacttgtgtagag
ggcactataccaagattactagagggaaaacttttttcctatatcaagtgtaccaaagtt
gattatgtttccacaagactagagccgttctatgacatccagttgaatgtaaaaggcaaa
aagaatatccatgattcatttaaagaatactgtgcttctgaactgttggatggtgacaat
aaatatgatgctggtgaacacggactgcaggaagccaaaaagggggtcatgttcaagaag
tttccaccagtccttcatctccagctgatgagattccagtatgaccctgtagctgatgca
aatgtgaaaattaatgacagatatgaattttatgataagattgaccttgatcgatacctg
caagaacttgaagacacacccgctgtgtatactcttcatgctgttttagtacacagtgga
gataatcatggtggtcattatgttgtatatataaacccaaaaggcgacggcaggtggtgc
aagttcgatgacgatgtggtttcattggcaaccaaacaagaagcaattgacaataacttt
ggaggttatgaggatgatgtcactgttaaacactgtactaatgcgtatatgctggtctat
ataagagatagtcatatcaatgaaattttagaagaagtaactaataatgaaattcctgac
acactggtgtcgaggttacaagaggagaggagacttgaagtgcaaagaagaaaagaaagg
acagaagctcatttgtatataactgtagaggttgttacagaagaccaattttgtggtcat
cacggatcagatttgtttgattttgaaaaggttaaaacaaaacacttcaaggttcttaaa
tcactgaaaatgcaagaagttctccaggttcttgcggacggaattgggtatcctgtggat
cagattcgcccatggcccttgcagcagcgcagcaatgggaccacaagaccggccgtgttc
gacatggagagtgatatagataagcctatcggacaactcgtggatgcctcctcctgggtg
atattcctcgagactgtagatccagagaacgggactgcacccttaccaagctatgacaaa
aagggtgatgttctgctattcttcaagtactatgaccctgcacagcgagtcttggcactt
gtcggacatctctatgtgccgcttgttacaaagttctcggaattaatgccatacctgtgc
gaaaaagctgggttgccgcaagggacacccctttttatgtttgaggaggttaaaattaac
tacgctgagcaaatccgggacacaagtctgaccatcgagcatggagtagaggaactaatg
gatggagacattatctgctaccagagaagtgataacgagttgttggaaacaagtgagctc
ccaacggtcatagagtatttcagggaccttcaccaccgagtggaggttctattctgtaac
aagaatcagcccgacgatcctggcttcactgtggttctgtcccagcgcatgaactatacg
caggttgccaaggcggttgctacgcatcttgaggtcgacccaatgaaactccagttcttt
aagggacagatttaccgtgacgcgccagggaatgcgttacggtgtacgtttgaaggtacg
ttgcgtgacctgctaatctattacaagccgcggggacccaagaagctgttttaccaaatt
ctgagcattcccatcaaccagctggagaataagagacagtttaagtgcatctggctcaac
gacagcaaggaggaacaagaactagtgctatggcctaacaaggaggcaacagtaggcgac
cttcttgaggaagccaaatcccacgtggattgcacgtcaacaggcaaattgcgtcttcta
gagatcatcagtgccaaagtgttcaacacgattaacaacgacgtaccgctagaacatctc
gtcagtcagggacaaaggatctttagaatcgaggagatcccttcagatgaaatagacctg
aaaacagacgaaattttaatacctgtggcgcacttcaacaaggaggtctaccagacgttc
ggcactcccttccttgtgcgcgtctctgatggagaatctatttccaatttacgagatcgc
gtcaaagccaaagtggatatcatagacaaggagtttgataagattaaacttgcaattgtc
cacatggggcgagtgaattatcttcctgacgaattggataaagtaatttctataaaggac
ttccaaccacagataactacaaattcacaacaaatcggaaaaccctggcttggccttgat
catgtgaacaaagctcccaagcgcacacggtacaattatctggaaagaccaatcaaaatc
cacaactga

DBGET integrated database retrieval system