KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g175574Help
Entry
NEMVE_v1g175574   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:nve00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:nve00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 297 aa AA seqDB search
MAPQTFFTNFTGYGKTGVRLLKIKRRSTLYHEIKELEVAVELKLRSKKDYLNGDNSDVIP
TDTQKNTIYALAKKHPLDSIEEFGLHVCKYFLDTHKHVDAVVIYINEAPWQRVKQGGIGH
AHAFIMTPDVQRFCEVSHVRGDEPKVFGGLRDMKVLKTTQSGFTGFLKDQYTSLPEVGDR
CFCTVVYCKYNFDSLAGVDFNAVHKLVKDVIIEDFSGPAKTGEYSASVQNTMYIAENSLL
EKIPQIGNIEMVMPNVHYFNVNMDAFGIKNDNEILMPVDKPSGIIKAGLSRQPKARL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgcaaacttttttcactaattttacaggctatggtaaaactggtgtccgtttg
cttaaaatcaagcgacgctcaacactttaccacgagatcaaagagctcgaagttgccgtt
gaactgaagctacgaagtaagaaggactacttgaatggcgataacagcgatgtgattccc
accgatacacagaaaaatacaatttatgccctagcaaagaaacatccgcttgattccata
gaggagtttggtttgcacgtgtgcaaatacttcctggacacgcacaagcacgttgacgca
gtagttatttacatcaatgaggctccatggcaacgtgtcaaacagggtggtattgggcat
gcgcacgcatttatcatgaccccggatgttcaacgcttctgcgaagtgtcgcatgtaaga
ggagatgaaccaaaggtgttcggtggcttgagagacatgaaggtgctgaaaaccacccag
tcaggattcacagggttccttaaggatcagtacacatccctccctgaggttggagaccgt
tgtttctgtacagttgtgtactgcaaatacaatttcgattccctcgctggcgtcgatttc
aatgccgtccataaactggtgaaggatgtgataatagaggatttctcagggccagccaaa
acaggggaatattcggcctcggtgcagaacaccatgtatattgccgagaactcgctactt
gagaaaatccctcagatcgggaacattgagatggttatgccaaacgttcactacttcaac
gtgaacatggatgctttcggaatcaagaatgataacgagatactgatgccagttgacaaa
ccttcgggaatcatcaaagcagggttgtcaaggcaaccgaaagcacgtctgtaa

DBGET integrated database retrieval system