KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g178554Help
Entry
NEMVE_v1g178554   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NEMVE_v1g178554
   00052 Galactose metabolism
    NEMVE_v1g178554
   00500 Starch and sucrose metabolism
    NEMVE_v1g178554
   00520 Amino sugar and nucleotide sugar metabolism
    NEMVE_v1g178554
Enzymes [BR:nve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NEMVE_v1g178554
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 500 aa AA seqDB search
METKDKVVDHVNVQQFKSLSRKDAFERMETEINKLIEFAPAPQKDLASKEMNNFKGLFKR
YLQETGPSVVWEKIHPPPKGLVVNYDEVSHAEPADIKAALDKLVVIKLNGGLGTTMGLVG
PKSLISVTQELTFLDLNIQQIEHLNNKYGSNVPLVLMNSFNTHEETVKTLRKYGAVNVRI
HCFNQSGHPRIATESLLPLASTYDKNPNSWYPPGHGDIYESFYNSGLLQKFIDEGKEYMF
VANIDNLGATVDLHILNYLLSESRKAPCEFVMEVTDKTRADVKGGTLIEYDNRLRLLEIA
QVPKQHVDEFKSVSKFRIFNTNNLWVNLKAVKRLVEKQAMDMEIIVNKKTLDDGVRIIQL
ETAVGAAMKNFEGAVGINVPRRRFLPVKKTSDLLLVKSNLYHMSHGVLIMSPLRQFPSVP
LVQLGSFFKKVNDFRDRFETIPDLLELDHLTVSGDVTFGKGVILKGTVIIIANHGDRIDI
PAGAILENKIVSGNLRILEH
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggagacaaaagataaagttgtggaccacgttaacgtccagcagttcaaaagtttgtca
cggaaagatgcattcgagcgaatggaaacagagatcaacaagctcattgaattcgcaccg
gcgccacagaaagatcttgcttcaaaagaaatgaacaacttcaagggcttgtttaagagg
tacctacaagagactgggccttctgtcgtctgggaaaagatccatccacctcccaaagga
ttggttgtgaattatgatgaggtatcccatgctgagcctgccgatatcaaggcagcgctg
gataagctcgtggtcatcaagttgaatggtggacttggtaccaccatgggccttgttggg
cccaagagtctgatatctgtcactcaggaactgacctttcttgatctcaacattcaacaa
attgagcatttgaacaacaagtatggctcaaatgtacccctggttctcatgaactccttt
aacacccacgaagaaacagtcaagacacttcgcaaatatggagctgtgaatgttagaatc
cactgtttcaaccagagtggccaccctagaatagctaccgagtctctactccctctggct
tcaacctacgataagaacccaaacagctggtaccctcctgggcatggtgacatatatgag
tcattctacaattctggcctccttcagaagtttattgacgaaggaaaggagtacatgttt
gttgccaacattgacaacttgggagcaacagttgatttacacatactaaactaccttcta
agtgagtctagaaaggcaccgtgtgagtttgtcatggaggttactgataagacaagagct
gatgtcaagggaggcacactcattgaatatgacaacagactccgactacttgagattgca
caagttcccaagcagcatgttgatgaattcaagtcagtgagcaaatttaggattttcaac
accaataatttatgggtgaatctgaaggctgtgaaacgccttgttgaaaaacaggccatg
gacatggaaatcattgtcaataaaaagacattagatgatggtgtgaggatcatacagcta
gagactgctgtaggggctgcaatgaagaactttgaaggggctgttggtatcaatgttcct
cgtcgccgtttcctgccggtaaagaagacctctgacctattattggtgaagtccaacctt
taccacatgagccatggagtccttatcatgagtccgctcagacagttcccttccgtcccc
ctggtccagcttggatctttctttaaaaaggtgaatgactttcgtgatcgctttgagacc
atcccagacctgcttgaactggaccatctgactgtctctggcgatgtcacatttggcaag
ggggtcattctcaagggcacagtgatcataatcgctaaccatggtgacaggatagacatc
cctgccggtgcaatacttgagaacaagattgtgtcaggcaaccttcgcatcctggagcat
taa

DBGET integrated database retrieval system