KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g178554Help
Entry
NEMVE_v1g178554   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NEMVE_v1g178554
   00052 Galactose metabolism
    NEMVE_v1g178554
   00500 Starch and sucrose metabolism
    NEMVE_v1g178554
   00520 Amino sugar and nucleotide sugar metabolism
    NEMVE_v1g178554
Enzymes [BR:nve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NEMVE_v1g178554
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 500 aa AA seqDB search
METKDKVVDHVNVQQFKSLSRKDAFERMETEINKLIEFAPAPQKDLASKEMNNFKGLFKR
YLQETGPSVVWEKIHPPPKGLVVNYDEVSHAEPADIKAALDKLVVIKLNGGLGTTMGLVG
PKSLISVTQELTFLDLNIQQIEHLNNKYGSNVPLVLMNSFNTHEETVKTLRKYGAVNVRI
HCFNQSGHPRIATESLLPLASTYDKNPNSWYPPGHGDIYESFYNSGLLQKFIDEGKEYMF
VANIDNLGATVDLHILNYLLSESRKAPCEFVMEVTDKTRADVKGGTLIEYDNRLRLLEIA
QVPKQHVDEFKSVSKFRIFNTNNLWVNLKAVKRLVEKQAMDMEIIVNKKTLDDGVRIIQL
ETAVGAAMKNFEGAVGINVPRRRFLPVKKTSDLLLVKSNLYHMSHGVLIMSPLRQFPSVP
LVQLGSFFKKVNDFRDRFETIPDLLELDHLTVSGDVTFGKGVILKGTVIIIANHGDRIDI
PAGAILENKIVSGNLRILEH
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggagacaaaagataaagttgtggaccacgttaacgtccagcagttcaaaagtttgtca
cggaaagatgcattcgagcgaatggaaacagagatcaacaagctcattgaattcgcaccg
gcgccacagaaagatcttgcttcaaaagaaatgaacaacttcaagggcttgtttaagagg
tacctacaagagactgggccttctgtcgtctgggaaaagatccatccacctcccaaagga
ttggttgtgaattatgatgaggtatcccatgctgagcctgccgatatcaaggcagcgctg
gataagctcgtggtcatcaagttgaatggtggacttggtaccaccatgggccttgttggg
cccaagagtctgatatctgtcactcaggaactgacctttcttgatctcaacattcaacaa
attgagcatttgaacaacaagtatggctcaaatgtacccctggttctcatgaactccttt
aacacccacgaagaaacagtcaagacacttcgcaaatatggagctgtgaatgttagaatc
cactgtttcaaccagagtggccaccctagaatagctaccgagtctctactccctctggct
tcaacctacgataagaacccaaacagctggtaccctcctgggcatggtgacatatatgag
tcattctacaattctggcctccttcagaagtttattgacgaaggaaaggagtacatgttt
gttgccaacattgacaacttgggagcaacagttgatttacacatactaaactaccttcta
agtgagtctagaaaggcaccgtgtgagtttgtcatggaggttactgataagacaagagct
gatgtcaagggaggcacactcattgaatatgacaacagactccgactacttgagattgca
caagttcccaagcagcatgttgatgaattcaagtcagtgagcaaatttaggattttcaac
accaataatttatgggtgaatctgaaggctgtgaaacgccttgttgaaaaacaggccatg
gacatggaaatcattgtcaataaaaagacattagatgatggtgtgaggatcatacagcta
gagactgctgtaggggctgcaatgaagaactttgaaggggctgttggtatcaatgttcct
cgtcgccgtttcctgccggtaaagaagacctctgacctattattggtgaagtccaacctt
taccacatgagccatggagtccttatcatgagtccgctcagacagttcccttccgtcccc
ctggtccagcttggatctttctttaaaaaggtgaatgactttcgtgatcgctttgagacc
atcccagacctgcttgaactggaccatctgactgtctctggcgatgtcacatttggcaag
ggggtcattctcaagggcacagtgatcataatcgctaaccatggtgacaggatagacatc
cctgccggtgcaatacttgagaacaagattgtgtcaggcaaccttcgcatcctggagcat
taa

DBGET integrated database retrieval system