KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g180219Help
Entry
NEMVE_v1g180219   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
FoxO signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:nve04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 375 aa AA seqDB search
MGDLPPGFYRTELVNTVYEVPRKYQELSPIGTGAYGQVCSSTITEPDPTNPDGPNTVAIK
KLSRPFQSTMHAKRTYRELKLLRHMRHENVISLLDVFTTASAFEHFQDVYMVTELMGSDL
NGILRFQKLSDEHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELKILDFGLAR
MTDAEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTSKTLFPGNDHIDQLT
KIMQLVGKPSDDFLQKIDSESARNYIAQMPDYRKTPFDEYFVGANPLAVDLLEKMLNLDT
DHRITAVEALSHPYLASYADPNDEPTCSTFDDSFDEKELSIEGWRALVYQEILDFQQKRS
MAIEEAAKEEEPMQS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgggagacttaccgcctgggttttatcggactgaactcgtcaatacagtgtacgaagtt
ccgcgcaagtatcaagagttgagtcctatcgggacaggagcttacggtcaagtttgctcc
tcaacaatcacagaaccagacccaacaaacccagatgggccaaacactgttgctatcaag
aagctttcaagaccctttcagtctaccatgcacgccaagagaacatacagagaattaaag
ctgttgagacacatgaggcatgagaatgtcattagtctgttagatgtcttcactactgca
tctgcctttgaacacttccaagatgtatacatggtaactgaactgatgggttcagacctg
aatggcattctgagatttcaaaagctgtctgatgaacatgtgcagtttttagtctaccag
atcctaagaggacttaaatatattcattcagccggagtaatccacagagatctaaagcca
agtaatattgcagtcaatgaagactgtgaattgaagattctggattttgggctagcaaga
atgacagatgctgagatgaccggttatgttgcaacacggtggtacagagcaccagaaatc
atgttgaactggatgcactacaatcaaacagttgacatttggtctgttggatgcattatg
gctgaacttttaacttcaaaaacactctttcctggaaatgaccacattgatcaactcaca
aaaattatgcaattggtgggcaaaccctctgacgatttcctgcaaaaaattgacagcgag
tcggcaagaaattacatagctcaaatgccagattatagaaaaacaccatttgatgagtat
ttcgttggagccaacccattagctgtagatttgttggaaaagatgttaaaccttgacaca
gatcatcggataacggctgtggaggctttaagccacccatacctagcatcctatgctgat
ccaaatgatgagccaacatgctccacttttgatgattcttttgatgagaaggaactgtct
attgaaggatggagagccttggtgtaccaagaaatcttggacttccaacagaagagatcc
atggctattgaggaggcggcaaaagaggaggaacctatgcagtcgtga

DBGET integrated database retrieval system