KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g180397Help
Entry
NEMVE_v1g180397   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    NEMVE_v1g180397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 109 aa AA seqDB search
MSIPEGDATKGAKIFKTKCSACHTVEAGGKHKTGPNLHGMFGRKTGQAEGYTYTPANLTK
GITWNDETLFVYLENPKKYIPGTKMVFAGIKKKNERADLIAYLKETTTS
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgagtataccagaaggcgatgctaccaagggggctaaaatattcaagacgaaatgttcg
gcttgccatacagtagaagcagggggaaagcataagacaggacctaatctgcatggcatg
tttgggcggaaaaccgggcaagcagagggctatacatatacgcctgccaatctaaccaaa
ggaatcacctggaatgatgaaaccctatttgtttacctggaaaatcccaagaaatacatt
ccaggaacaaaaatggttttcgctggaataaagaaaaagaacgagcgagcagacttgatc
gcttatttgaaggaaactacaactagctga

DBGET integrated database retrieval system