KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g183768Help
Entry
NEMVE_v1g183768   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    NEMVE_v1g183768
Enzymes [BR:nve01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     NEMVE_v1g183768
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 690 aa AA seqDB search
MFCGDCNSAYHPDCIGLSTAPKGKFKCDECTSGVHSCFVCRQTGDVKACSQPLCSKFYHK
ECLQSYKCSKIDGDRIYCPLHFCSTCISNKTPVNRGRLTKCIRCPTAYHAGCLVAGCMPI
TSHLMVCAKHFLPNKSKAHHTHVNVNWCFVCSIGGTLICCESCPAAFHPECISYEGIPEG
RFYCKDCVEGKSLLYGDIVWVKLGMYRWWPAMICNPRDVPTNIQSMRHQPGEFPVMFLGS
HDFYWIHKGRVFSYQDGDKGTESGNNKYLAKVFKKALVEAKEKYDEWKKAREDKAEQDLQ
RFCKKPPQYKHIKTNKCTTAQRIILDPSEMPVCECTPDQACGQDANCLNLMLQFECVASR
CPAGDKCQNQRFQKRQYVDCEPFRAHSRGWGLRSKQAIKKGTFVIEYVGELIDDATCRER
VKKGDDDTNYYMLTIDKDCIIDAGPMGNLSRFMNHSCYPNCETQKWTVNGEVRVGLFTSR
DVESQEELTFDYCLDCHGNEKKKCHCGSQNCSGFLGVRPKTQNAQMNEDKAKNAALKRRK
RKPKKPAVKQVHEDDCFICGDGGQLIMCDRSGCLKCYHVDCLNLDKKPQGRWQCPWHFCD
NCGKRATVLCSECPNSFCRSHAQGQINSTDKNTFLCTDHVDEVLPGMTDKFLATDQVLNA
LDLINGDLTGIRPTELDHLQQKPEYLELGS
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgttttgcggcgactgtaacagtgcctatcacccggactgtattggtttaagcacggcc
ccaaaagggaaattcaaatgcgatgaatgtacatctggtgttcattcttgttttgtctgt
cggcaaactggggacgttaaagcttgcagccaaccactgtgctctaaattttaccacaag
gaatgcttgcagtcgtacaaatgttccaagattgatggtgatcgcatctactgtccttta
cacttttgcagcacttgtatatcaaacaagacccctgttaataggggtaggctgacaaaa
tgcatccggtgtcccactgcttaccatgcagggtgcctagtcgcggggtgcatgccaatc
acgtcacatctaatggtgtgtgccaaacacttcttgccgaataagagcaaagcccatcac
actcacgtcaatgtgaattggtgctttgtgtgttctattggcggcacattgatttgttgt
gagagttgccctgcagcttttcatcctgagtgcatcagctatgaaggcatacctgagggc
cgtttttactgtaaggactgtgtggagggcaaatcattactgtatggtgacattgtttgg
gtcaagcttggaatgtacagatggtggccagcaatgatttgtaatccccgagatgtgcct
accaacatccagtcaatgcgtcaccagcctggcgagttccctgtcatgttcttggggtca
catgacttctattggatccacaaggggagggtgttcagctaccaggatggggacaaaggc
acagaatctggaaataacaaatatcttgccaaagttttcaaaaaagcacttgttgaggcg
aaagagaaatacgatgagtggaaaaaggcaagagaggacaaagctgagcaggatcttcag
aggttttgcaaaaagccaccacagtataaacatattaagaccaacaagtgcaccacagca
cagagaataatccttgacccgagtgagatgccggtgtgtgagtgtacccctgatcaggct
tgtggacaagacgccaactgcctgaacctcatgctgcagtttgagtgtgttgcatctaga
tgtccggcaggagacaaatgtcagaaccagaggttccaaaagcgccaatatgtggactgt
gagccattccgggcacactccagaggatggggcctacgatcaaagcaagctatcaagaaa
gggacgtttgtcatagagtatgtgggagagctgatagatgatgccacctgtcgggaacgc
gtcaagaagggtgacgatgacactaactattacatgcttaccatcgacaaggattgcatc
atagatgctggccccatgggcaatctctcacgatttatgaaccatagctgttacccaaac
tgtgagactcaaaagtggactgtgaatggggaagtacgtgttggtctctttacatcacgg
gatgttgagtcacaggaggagctaacctttgattactgtttggactgccatggtaatgag
aaaaagaagtgtcactgtggatctcagaattgcagtggctttcttggggtgcggcccaaa
actcagaatgcacaaatgaatgaagataaagccaagaatgctgccttgaagcgcaggaag
aggaaaccgaaaaagcctgcagttaaacaagtacatgaagatgattgcttcatctgcggc
gatggaggccagctcatcatgtgtgaccgaagtggctgcctcaaatgctaccatgttgac
tgcctgaaccttgataagaagcctcaaggccggtggcagtgtccctggcacttctgtgac
aactgcggcaagcgggccactgtcctctgctcagagtgtcccaactcattctgcaggagc
cacgcccaagggcagatcaacagcactgacaagaataccttcctttgcacagaccatgta
gacgaggttcttcctggaatgactgataagttcctggccaccgaccaagtgctgaacgcc
cttgacctcatcaacggggaccttactggtattaggcccaccgagctcgaccatttgcag
cagaagcctgagtaccttgagctgggttcctga

DBGET integrated database retrieval system