KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g186732Help
Entry
NEMVE_v1g186732   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K17610  calcineurin B homologous protein 1
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Protein phosphatases and associated proteins [BR:nve01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     NEMVE_v1g186732
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 SPARC_Ca_bdg EF-hand_9
Motif
Other DBs
NCBI-GeneID: 5511998
NCBI-ProteinID: XP_001632366
JGI: 186732
UniProt: A7S7U9
AA seq 193 aa AA seqDB search
MGLKSSSLLQEEDLAEIQRETGFSPKQISRLYSRFSNLDKANQGTLTREDFLRIPELAIN
PLGDRIVDAFFMNQEEAGLQEQCNFKQFVRTLAHFRPFHGHSPNPLNTREEKLKFAFRIY
DIDSDGYISKTDLIAILHMMVGVTISDEHLTGIADRAISDADTDGDKLISFAELKKVMED
VDLNAKMSIRFLA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgggcctcaagtcttcctcgctccttcaagaggaagatcttgcggagattcagcgcgaa
acaggattctcacccaagcagatctcaagattatacagccgattctcaaatctcgataag
gcaaatcaagggactctcacgcgagaggactttcttagaataccagaattggcaataaac
ccacttggtgacagaatagtggatgcatttttcatgaaccaggaagaagcaggattgcaa
gaacagtgtaacttcaagcagtttgtgcggacacttgcccacttcagacccttccatgga
cactcgcccaaccctctgaacacaagagaagaaaagctgaaatttgccttcagaatatat
gacattgatagtgatggctatatctctaagactgacctgattgcaattctccacatgatg
gtgggtgttactatcagtgatgagcatcttacaggaattgccgaccgtgccataagcgat
gctgatacggatggggataagttgatatcatttgctgagctcaagaaggtgatggaagac
gttgatttgaatgcaaagatgagcattcgtttcctggcgtaa

DBGET integrated database retrieval system