KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g187451Help
Entry
NEMVE_v1g187451   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
nve  Nematostella vectensis (sea anemone)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 668 aa AA seqDB search
MSTEVASKPLFGYVDIVLLASFVGVVLYWFCGRKKKNEFVMPTKLMVAPSIIKQSADDNS
FIGKLKKSGKPLAIFYGSQTGTAEEFASRLAKDAQRYGIKAMVFDPEENDMEELTRMGEI
DNSFAIFVMATYGEGDPTDNAQEFYEWLQNDRDDLDCLNFAVFGLGNKTYEHYNSMGRYV
DKRLEELGGYRIYQRGEGDDDGNIEEDFVRWREEFWPAVLKYFNINVRDIKRRLSSCIER
QFRLNEQRDTPQEKVFTGEIARLKAYERQRPPYDAKNPFLAPIVINRELHKGGDRSCMHI
ELDITGSGIKYDAGDHVAVYPTNNLDLVEKFSQLLNVDLDTVFSLDNVDEDASKKHPFPC
PTTYRTALMHYVDITSTVKTHVLRELAEYARDHEEKEFLMAISDSTEEAKKKYNEWVIQP
HRHIVAVLEDMPSLKPPLDHILELLPRLQCRYYSISSSPKAHPSHIHVTAVVVKWTTKTG
RVQNGVATTWLATKIPKGWVPIFVRRTTFRLPFKPVTPVIMIGPGTGLAPFRGFIQDRNA
LVKQGKRVGDTVLFFGCRHKAQDYIYENELEDYAADGTISRLHVAFSRDQDKKRYVTHLM
RENTDEIWNLLDQGAHIYVCGDARNMARDVHTIVTEIAREKGGMTDSQADDYVKKLSAKG
RYATDVWS
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgaagttgcgagcaagccgctttttggatatgttgatatagtacttctggcc
tcgtttgttggggtcgttctctattggttttgtggacgcaagaaaaagaacgagtttgta
atgcccaccaagctcatggttgcgccaagcattattaaacagtctgctgatgataacagt
tttattggcaagctgaaaaaatctggcaagccactagccattttttatggctctcaaaca
gggacagctgaggagtttgcaagccgtttagctaaggatgctcagagatatggcatcaag
gcaatggtgtttgacccagaggaaaatgacatggaagagttaactcgcatgggagaaatt
gataacagctttgctatatttgtgatggccacatatggtgagggtgaccctacagataat
gcacaggaattctatgaatggctacagaatgacagagatgatctggactgtctcaatttt
gctgtttttggcctgggaaacaagacctatgaacactataattccatggggcgatatgta
gacaaacgcctggaggaactcgggggatacagaatataccaaagaggagagggtgatgat
gatggcaatatagaggaagactttgttcgatggagagaagaattttggcctgccgttctt
aagtacttcaatatcaatgtccgggatatcaaaaggcgtctttcgtcttgtatcgaaagg
caattcaggctcaacgaacagagggatacacctcaagaaaaagtattcactggcgagatc
gcaagactcaaagcctacgaacgccagagaccgccgtacgatgctaaaaatcctttcctg
gcgcccatcgtcatcaaccgtgagttacacaagggaggagacaggtcttgcatgcacatt
gagctggacatcacaggatctgggatcaagtatgatgctggtgaccatgttgcagtctac
ccgacaaataacttggatcttgttgaaaagttcagccagcttctaaatgttgacctggat
accgtcttctctctcgacaatgtggacgaggacgcatcaaagaaacacccttttccctgc
cccacaacctatcgcactgctctcatgcactatgtagacatcacgagtactgtgaagacc
catgtgctacgcgaactggcagagtatgcacgtgatcacgaggaaaaggagttccttatg
gctatcagtgacagtacagaggaagccaagaaaaaatataacgaatgggtgattcagcct
catcgacatatcgtcgctgttcttgaggacatgccctccctgaaaccaccccttgaccac
attctcgagctactgccacgcctacagtgtagatactactccatctcctcgtcaccaaag
gctcacccatctcacattcatgtcactgctgttgtcgtgaaatggacgacaaaaactggc
cgagtacaaaacggagtggcgaccacttggcttgccaccaagatccctaaaggttgggtg
ccaatctttgtacggaggaccacattccgccttccattcaagcccgtcactccggttatt
atgatcggacccggcactggactcgcaccattcaggggcttcatccaggaccgcaatgcg
ctcgtcaaacaaggcaaacgtgtgggtgatacggtgctgttcttcgggtgtcgccacaag
gctcaggattacatctatgagaatgaacttgaggattacgccgcggacggcacgatatcg
aggctgcacgtcgccttctctagagaccaggataaaaaaaggtacgtaactcatctgatg
agggagaacactgacgagatttggaatctgctagaccaaggagcccatatctacgtatgc
ggcgacgcacgcaatatggccagagacgtgcacaccatagtgacggagattgcgcgggag
aaaggaggcatgacagatagccaagcggatgattacgtcaagaagctgagcgctaagggg
cgatacgccaccgacgtttggagctga

DBGET integrated database retrieval system