KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g187737Help
Entry
NEMVE_v1g187737   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NEMVE_v1g187737
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NEMVE_v1g187737
   00620 Pyruvate metabolism
    NEMVE_v1g187737
   00640 Propanoate metabolism
    NEMVE_v1g187737
Enzymes [BR:nve01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     NEMVE_v1g187737
Lipid biosynthesis proteins [BR:nve01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   NEMVE_v1g187737
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 601 aa AA seqDB search
MDCDMNEGQHRWFVGGEINVSENCVDHHMRSHPNRTALIWEKDEPGDVEHVSYIQLYGMV
NRMANMLKCHGVKKGDIVCLYMPVSPLAVAAMLACARIGAPHSVVFAGFSADALASRIND
AQAETVITANQAVRGGRAIDLKRVVDDAVSKSPGVKRVFVMKRTGAQVPMGKLDIPLEEA
MAEQPDECPPEPMDSEDPLFLLYTSGSTGQPKGIVHTQAGYLLYAKLTHKYCFDYKQGDV
FGCVADIGWITGHSYVVYGPLANGATTVLFESTPTYPDPGRYWEMVERLRINQFYGAPTA
IRLLLKSGNSWVEKYDRSSLKVLGTVGEPINEEAWHWYNDVVGEKRCTVVDTWWQTETGG
ILISPRPAPDNSPVKPEFPMRPFFGVDPVLVDEKGKELTGNNVTGALCFRSSVPGMCRTI
YGHHERFLNTYYRPYPGYYFTGDGALRDKDGHYRITGRMDDVVNVSGKRLGTAEVEDAMD
NHSAVAETAVVGFPHPIKGEGIYAYATLKDDAQIEPEQFREEVKKLVRQKIGAFAVPEII
QVVPGLPKTRSGKIMRRILRKVAQDKPDELGDVSTLADPSVVEVIVRQHTEVMDRIKSKV
K
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggattgcgatatgaacgaggggcaacatcgctggtttgttggaggggagatcaacgtt
tcagagaattgtgttgatcaccacatgaggtctcaccctaatcgcactgcactgatctgg
gaaaaggatgagccaggggatgtggagcatgtctcctatatccagctgtatggcatggtt
aaccgaatggctaacatgttgaagtgccatggagtgaaaaagggtgacattgtgtgtctg
tacatgccagtatcgccgcttgctgttgccgccatgcttgcatgtgcacggattggtgca
cctcacagtgttgtgtttgcaggatttagtgctgatgccttagccagcaggattaatgac
gcacaagcggagacagtaattacagcaaaccaggctgtccgtggtgggcgggcgatagac
ctcaagcgtgtggttgatgatgctgtgtccaaaagcccaggagtcaagcgtgtgtttgta
atgaagcgaacaggtgctcaagtgccaatgggcaagctggacattcctctggaagaagcc
atggctgaacagccagatgagtgcccgccagaaccaatggatagcgaggaccctctcttt
ctactctacacatcaggcagcacaggccaacccaaagggatcgtacacacgcaggcaggg
tacctactttatgcaaaactcacccataagtactgcttcgactacaagcaaggcgatgtg
ttcggctgcgttgctgacatcggttggatcacagggcactcatacgttgtgtatggacca
ctggctaatggggccaccacagtcctgttcgagagcacccctacatatccggacccggga
cgttattgggaaatggtcgagcggctacgcatcaatcagttctatggagctcccaccgcg
atacggttactactgaagtctggaaactcatgggttgaaaagtatgatcgatcatctctg
aaggtgttaggcactgttggcgagcctataaacgaggaagcctggcactggtacaatgac
gtcgttggcgaaaagcgctgtactgttgtggacacgtggtggcaaacagagactggcggc
atcctgatctcacctcgacctgccccggacaacagtccagttaaaccggaattccccatg
aggcctttttttggtgtggacccggttttggtggacgaaaagggtaaagaacttaccgga
aataacgtgacaggagccctgtgtttccggtcttctgtacccggcatgtgtcgaactatc
tacggccaccacgagcgcttcctcaacacttactaccgtccctaccccggttactacttt
accggtgacggggctcttcgagataaagatggtcactacagaatcacgggaaggatggat
gacgtcgtcaatgttagcggcaagagactgggcacggcggaagtggaggatgccatggat
aatcacagtgcagtggcagagacggcggttgtcggcttcccgcatcccatcaagggagaa
ggtatctatgcttatgccactttgaaggacgacgcacagatcgagcctgagcagttcaga
gaagaagtaaaaaaactcgttcgacaaaaaatcggcgcctttgctgtccccgaaatcata
caggtcgtaccaggacttcccaagacgaggtctggtaaaatcatgcgtcgcattttgcgt
aaggtggctcaggacaagccagacgagttaggggacgtgtcgacactagccgacccctcg
gtggtggaggtcatagtgcgacaacatacagaggtgatggatagaatcaaaagcaaggtc
aagtag

DBGET integrated database retrieval system