KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g188209Help
Entry
NEMVE_v1g188209   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K10747  
DNA ligase 1 [EC:6.5.1.1]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:nve03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:nve03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:nve03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:nve03430]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 609 aa AA seqDB search
MSILSNFFRSVIALTPNDLLPCVYLCLNKLAPAYEGIELGIGDHILMKAVSEATGKILSQ
IKADLADKGDLGLVAEASRSNQRTMFAPPKLTAASVYSKLKDIALFTGHSSTGKKVDIIK
GMFVACRHSEARYLIRSLSGKLRIGLAEQSVLTALAHSVVLTPPSSEFPPPVIDAAKTLS
SDELKKMLDAGALTVKTCYCELPNYNKIIPALLEYGLEDLPNKCYLTPGVPLKPMLAHPS
KGVAEVLKRFEGSAFTCEYKYDGERAQIHLLENGEIHIYSRNQENNTSKYPDIISRMPKV
MSEEIKSFIIDTEAVAWDREKQQILPFQILSTRKRKDADVSEIKVQVCVYAFDLLYLNGK
SYVKEPFSVRRNLLRTSFKEAEGEFVFAKCMTSTNTEDMAEFLEESIKGNCEGLMVKTLD
VDATYEIAKRSHNWLKLKKDYLADVGDTLDLVPIGGYRGKGKRTGAYGGFLLACYDAESE
EFQTICKIGTGFTDEVLESHHQFFKDHVIDKPKPYYRYDDGLEPDHWFDAVQVWEVRAAD
LSVSPVHKAAVGQVDPVKGISLRFPRFLRVRDDKKPEEATDSTQVAEMYRDQDSVKNNAV
TTNQEEDFY
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgtccattctcagcaacttttttagatctgtgattgcattaacaccgaatgaccttctt
ccatgtgtctatctttgcttgaataagcttgccccagcatatgaaggaatagagcttggt
attggagatcacatcctcatgaaagccgtctctgaagctacaggtaaaattctctcccaa
atcaaagctgacttggcagacaaaggggatcttggtcttgttgctgaggctagtcggagc
aaccagcgtactatgtttgcgcctccaaaactcacagcagccagtgtttacagcaagctt
aaggacatagcattattcactggacatagttctacaggaaaaaaagtagacattattaaa
ggaatgtttgtggcgtgtcgtcactctgaagcaaggtacctcattcggtcacttagtggc
aagctcaggataggacttgcagaacagtcagtcctcactgcactggctcactctgtggta
cttacacctcctagttcagaatttcctccacctgtgattgatgcggctaagacgttgtct
agtgatgaacttaaaaagatgttagatgcaggcgcacttacagtcaagacatgttactgt
gaactaccaaactataacaagatcatacctgcacttctggagtatggacttgaggatctg
cccaataaatgctaccttacgccaggagtgcctttgaagcccatgttggcacacccctct
aagggtgtggccgaagtactcaaaaggtttgaaggcagtgccttcacatgtgaatacaag
tatgatggtgaacgtgctcagatacatcttctggaaaatggcgaaatccacatttatagt
agaaaccaggaaaacaacacatcaaaatatccagatatcatttcaaggatgcccaaggtc
atgtcagaggaaatcaagtccttcatcatcgacactgaagcagtagcttgggaccgagag
aagcaacaaattctgccattccagattcttagcacaaggaaaagaaaggatgcggatgtt
tccgagatcaaagtgcaagtttgtgtctacgccttcgatctactctacctcaatgggaag
tcttatgtgaaggaacctttcagtgtcaggaggaaccttctgagaacatctttcaaggaa
gctgaaggggaattcgtgttcgctaaatgcatgacttcaacaaacacggaagacatggca
gagttcttggaagagtcgattaaaggtaattgcgaggggttgatggttaagactttagac
gttgatgccacctacgaaatcgctaagaggtctcataactggcttaagttgaagaaagac
tatcttgctgacgtcggcgacaccctcgacctagtccccatcggaggctatcgaggcaag
gggaaaaggactggggcctacggtggctttctgttggcttgttatgatgcggagagtgaa
gagtttcaaacaatttgcaagatcggaaccggcttcacggatgaagttctcgagagccac
catcagttcttcaaggatcacgtgatcgacaagcccaaaccgtattatcgctatgacgac
ggactggagcctgatcattggtttgacgccgtccaggtgtgggaggtgagggccgctgac
ctgtccgtctctcccgtccacaaagctgcggtcggacaagtggaccccgtcaagggcatc
tcgctgcggttcccgcgctttctgcgcgtgcgcgatgacaaaaagcctgaagaggcaaca
gacagcactcaggttgccgagatgtacagagatcaagacagtgtaaagaacaatgcagta
acaacaaatcaggaggaagatttctattaa

DBGET integrated database retrieval system