KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g189422Help
Entry
NEMVE_v1g189422   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00440  Phosphonate and phosphinate metabolism
nve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    NEMVE_v1g189422
Enzymes [BR:nve01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     NEMVE_v1g189422
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEP_mutase ICL
Motif
Other DBs
NCBI-GeneID: 5508858
NCBI-ProteinID: XP_001629439
JGI: 189422
UniProt: A7SG07
AA seq 282 aa AA seqDB search
MLESPELEFIMEAHNGLSAKIVQEAGFKGIWGSGLSISAQLGVRDSNEASWTQVTDVMEF
MSDATDIPILLDADTGYGNFNNARRLVKKLEMRGVAGACLEDKLFPKTNSLLDGRAQPLA
EVDEFALKIKACKETQSDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKK
SDPSDIEAFMKAWNNQGPVVIVPTKYYTVPTDHFRDLGVSMIIWANHNMRASVAAMQQTT
QQIMKDQSLVNVEDKIVPVKEVFRLQGDQELKEAENKYLPQQ
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgctagagtccccagagctggaatttatcatggaggcccataatgggctgagtgcaaaa
atagtacaggaagctggattcaaaggcatctggggtagtggtttgtccatctcggcacag
ctcggcgtcagggatagcaatgaggcatcttggactcaggttactgatgtgatggagttc
atgagtgatgccaccgacatccccattttactagatgctgacacgggctatggcaacttt
aacaatgcccgccgacttgtgaagaagctagagatgaggggcgtagcaggggcgtgtcta
gaagataagctgtttcccaagacaaactccttgttagatggacgtgcccagccccttgcc
gaagttgacgagtttgccctgaaaatcaaggcttgcaaagaaactcagtcagacccagat
ttctgcatagttgccagagttgaggctttcatcgcaggctgggggcttgatgaggcactg
aaacgtgccgaggcatatcgtaatgccggtgcagacgctatacttatgcacagcaagaag
tctgacccgtcagatatagaggcatttatgaaagcttggaataaccagggccctgttgtc
attgtgccaaccaagtactatactgtaccaactgatcacttccgtgacttaggagtgtcc
atgatcatctgggcaaaccacaacatgcgtgcatctgtggcagcaatgcagcagacaaca
caacaaatcatgaaagatcagtctcttgtaaatgtagaagataagattgtccctgtgaag
gaggtcttcagattacagggagaccaggaactaaaggaagcagaaaacaaatatctacca
cagcaatga

DBGET integrated database retrieval system