KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g190461Help
Entry
NEMVE_v1g190461   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NEMVE_v1g190461
   00330 Arginine and proline metabolism
    NEMVE_v1g190461
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    NEMVE_v1g190461
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    NEMVE_v1g190461
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    NEMVE_v1g190461
Enzymes [BR:nve01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     NEMVE_v1g190461
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 347 aa AA seqDB search
MAPRVAVVGCGVIGATSALEILQSNPSVRLTVIADTFSPENTSDGAAGLLMPFAVGETDP
GLVRRWFKETMRRFEELLRSEIAPELGVFRASGCLVADHQQEIPDWKDLVYGFKQMSREE
LERFPLSAKIGFVFETIIAQGSYYIPWLMKRIQHYGGKIVKRRLDSFQELARSFDVVVNC
CGLGAKGLAQDRHMFPIRGQILRVKAPWIKQFILYEKYEDLKAGRLNDIIPQMDHVVLGG
CAQAGSFNTVPTLQDTVNIIEDTSKVIPALKNAEVISNWSGLRPGRKTVRLEKEVMLFKD
ESGCIIKLNVVHNYGHGGAGPSLSFGCAKDTADLVAQILSRDAKSML
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgagggtagcagtagtcggctgtggtgttattggagctacttctgctctagaa
attctgcagtcaaacccttcagtaaggcttaccgtaatagctgatacatttagccctgaa
aacaccagcgatggagcggcgggtttgctcatgccttttgcagttggtgaaaccgacccc
gggctagttaggcgatggttcaaagagaccatgagaagatttgaagagcttctgagaagt
gaaattgctcccgagcttggagtcttccgtgcgtcaggatgcttggtggcagaccaccaa
caagagattccagactggaaagacctggtctatggcttcaaacaaatgagcagagaagag
cttgaaaggtttcccctttctgccaagattggttttgtatttgagactatcattgcacaa
gggagctactacattccctggctgatgaaaaggatacaacattatggtgggaaaattgtg
aaaagaagacttgattcattccaagagctcgctagatcctttgatgtagttgtgaactgc
tgtggccttggagcaaaggggctggcccaggaccgtcacatgtttcctatcagaggccaa
atactccgtgttaaagcaccatggatcaaacagttcattttatatgagaaatatgaagac
ttgaaagctggaagattaaatgatattattccccagatggaccatgtggtgttaggaggg
tgtgcgcaggctggcagcttcaacacagtgccaaccctccaagacacagtgaacatcatt
gaggatacatctaaagtcatacctgctcttaagaatgctgaggtcatcagcaactggtca
ggtttacggccaggcaggaaaacagtgagactggaaaaagaagtgatgcttttcaaagat
gaatcaggatgcataattaaattaaacgtcgttcataactacggtcatggaggagccggc
ccctcgttgtcatttggctgcgctaaggacaccgctgaccttgtggcgcaaatattgtca
cgtgacgcaaagtccatgctttga

DBGET integrated database retrieval system