KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g192479Help
Entry
NEMVE_v1g192479   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K06129  lysophospholipase III [EC:3.1.1.5]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00564  Glycerophospholipid metabolism
nve04142  Lysosome
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NEMVE_v1g192479
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    NEMVE_v1g192479
Enzymes [BR:nve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     NEMVE_v1g192479
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LCAT Ser_hydrolase
Motif
Other DBs
NCBI-GeneID: 5505220
NCBI-ProteinID: XP_001626066
JGI: 192479
UniProt: A7SQQ2
AA seq 410 aa AA seqDB search
MTNRTLFLVISIAVIVIVRGRVTREQGSSAQIKNPVVIVPGTGGSQIEAKLNKPTTKHWY
CHNTWSDYFTLWLQESFLLPMFIDCWVDNMRLVYDPATKTVHNSPGVETRVPGFGDTNTI
EYLDKRNLIAYFAPLVKAMVSWGYERGKNLRAAPYDFRYAPDSQADYYIRLRQLIEDTYT
QNGEKQVTLLSHSLGCPYTLVFLNQQSTAWKDKYIKQWVALSGVWGGTTQLVRLFASGDA
FGIPLVNPLTVRVEQRTCSSNNFMLPSRELWRSDEVLVTTPDRKYTVRDFEDYFRDVGYP
DGIPVRRNLENLTAPLLQHAPNVTLHCLHGSGVDTEESYTYGKGEFPDEQPTIRNGDGDG
TVNARSLRACATWVNRQGYDVVVKDYAGVNHNGILSDAKAQAYIKSIVIN
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgactaaccgtactttattcctcgtgataagtatcgcggtcattgtgatcgtgcgcgga
cgcgtgacgcgtgagcaagggtcttccgctcaaatcaagaaccccgtcgtaatagtccca
ggtactggtggaagtcagattgaggcaaagctgaacaagcccacgaccaagcattggtac
tgccataacacctggtctgattattttaccctttggctgcaggagagctttctacttccc
atgttcatagactgctgggtagataacatgaggcttgtgtacgaccctgccaccaaaact
gtccacaactccccgggcgtagagacacgagtgccagggtttggcgacacgaacaccatc
gagtacttagacaaacgcaacctcatagcttatttcgcaccgcttgtgaaggcaatggtc
agctgggggtatgagcgaggaaagaacctcagggctgctccttatgacttcagatatgca
ccggactcgcaggcagattactatatcaggctgcgccaactgatcgaggacacctacaca
cagaatggcgagaaacaggttactcttctatctcacagccttggctgcccttacaccttg
gtcttcctgaaccaacagagcacggcctggaaggacaagtacatcaagcagtgggtagca
ctctcaggtgtgtggggaggtacgacccagcttgtccgactttttgcgtccggtgatgcg
tttggtatcccattggtgaatccccttacggtgcgtgtagagcagcgcacttgcagtagc
aacaatttcatgctgccaagtcgggagctgtggagatccgatgaagtcctggtaaccacc
ccagaccggaagtacacagtgcgtgacttcgaggattacttccgggatgtgggctaccct
gatgggattcctgtgcggcggaacctcgagaatctgaccgctccgttactccagcacgct
cctaatgtaactttacactgtctacacgggtcaggcgtggataccgaagaatcgtatact
tacggcaagggagaattccctgatgaacagcctacgatacgaaatggcgatggagatggc
acggttaacgcaagaagtcttcgcgcatgcgcgacatgggtcaatcggcaaggatatgac
gtcgttgtcaaagattacgccggtgtcaatcataatggcatcttaagcgatgctaaagca
caggcctatattaagagcattgtgataaattaa

DBGET integrated database retrieval system