KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g194441Help
Entry
NEMVE_v1g194441   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    NEMVE_v1g194441
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    NEMVE_v1g194441
Enzymes [BR:nve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     NEMVE_v1g194441
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 783 aa AA seqDB search
MKYATKEKKNGRVPYIDPLAANPCRQVYGVPLGGIGCGTIGRGWRGEFNRWQLTPGIYSY
NYVEANQFVVCVRKKGRTTYQAVLSPNRPNGVLCGRSLQGWNWGFSGSNAVYHALYPRAW
TRYELPGQDIILVCRQVSPVFPHDYKDTSLPVAVFIWSIENNNNEEVEVSIMFSFENGDG
TQDLTAGHYNESADTTGSNTTCDVTGVLLHHKHHKLPYTLAIAAKALHKKELVTVTTKTW
FDSRTPCRRVWNDLMDDGKLNSSTEPSPPSRSDQSLCAAVAATTTVAARSRGELEFALAW
DMPVIYFGNSKKRHYRYYTRYFGHQGNAGPALCSHALMSYPDWETKIEAWQKPILQDESL
PNWYKSALFNELYFVADGGTVWLDVRSESGTSKGTADIVRKIGRFAYLEGHEYRMYNTYD
VHFYASFALAMLWPKLQLSLQYDMAHAVNVSDNQVVMTMMNGHYCRKKVPGCIPHDIGDP
SEAPWDHVNAYHIHDTSKWKDLNLKFVLQVYRDYVFTNDVYYLQDMWPITKTVMTKSMTY
DSDGDGLIENSGLADQTFDAWPVTGPSAYCGGLWLAALRVMAEIATILDFPDERGKYEKI
LARGKKAYERLLWNGKYYNYDSSTSKYHNSIMADQLSGQWYLHACDLAQTSNDRVFPSEN
VISALRTVFNFNVMKFQEGTMGAVNGIRPDGQLDTSSLQAEEVWTGVTYAVAASMIQEGL
VDEGFKTASGIYNTCFERLGMNFQTPEAIVANGNYRSLAYMRPLSIWAMQWALEKRKNKR
ESS
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatgctacgaaggagaagaagaatggaagagtgccgtatattgacccattggct
gcaaacccgtgtcgacaagtttacggtgtgccacttggtggtattgggtgtgggacaata
gggcgtggctggcgaggcgagttcaaccgatggcagttaaccccaggaatttactcctac
aactatgttgaggctaatcagttcgttgtatgtgtgaggaaaaaagggaggaccacctac
caggccgttctttctcctaatcgtccaaatggtgttctgtgtggccggagcctgcagggc
tggaactgggggttcagcggttctaatgcagtgtaccatgctctgtatccgcgtgcgtgg
acccggtacgagttgcccggtcaggacatcatcttggtttgtcgacaagtctctccagtc
ttcccccatgattataaggacacgagccttcccgtggctgttttcatctggtctatagaa
aacaataacaacgaagaagtggaagtgtcaatcatgttctcgttcgagaatggggatggt
acccaggacctcacggccggacactacaacgaatccgccgatacgaccggaagtaacaca
acgtgtgatgtcacgggagtgttattacaccataaacaccacaagttaccctacacgtta
gcgatcgcagcgaaggctctacataagaaagaactggttaccgtgacaacgaaaacatgg
ttcgactcaaggacgccgtgccgcagagtatggaatgacctgatggatgacgggaagctt
aactcgtccacagaaccaagccctccgtccaggtcggaccagtccctttgtgcagcagtt
gctgcgacgaccaccgtggctgcgcgttcccggggcgagctggagtttgccttggcttgg
gatatgcccgtgatatattttggtaacagcaaaaagagacattacaggtattatacccgt
tatttcggtcaccaaggcaacgcaggccccgccttatgtagccacgcccttatgagttat
cctgactgggagacgaagatcgaggcgtggcagaaacccatactacaagacgagtcacta
cccaactggtacaaatcagcgctttttaacgagctctactttgtcgctgatgggggaact
gtctggctggatgtccgttcggagtctgggactagtaagggtacagctgacattgtccga
aagattggaagattcgcatatcttgaaggccatgagtaccggatgtacaatacgtacgat
gtgcatttttacgcgtcttttgcgctcgccatgctttggcccaagctacaactgagcctg
cagtacgacatggcgcacgctgttaacgtctccgacaatcaggttgtcatgacgatgatg
aatgggcactactgtaggaagaaagtccccggatgtatcccacatgacatcggtgatcca
tccgaggcgccttgggatcacgtgaacgcttatcacattcacgacacatcaaaatggaaa
gacctcaacctcaagtttgtgcttcaggtgtacagggactatgtattcaccaacgatgtc
tactacctgcaagatatgtggcccatcaccaagactgttatgaccaagtccatgacgtat
gactcagacggcgatggactcatcgagaactctgggcttgccgatcaaacattcgacgcg
tggcctgtcacaggccctagtgcctattgtgggggactgtggctcgccgctctgcgtgtt
atggctgagattgctaccatcctagacttccctgatgagagagggaaatacgagaagatc
ttggcgaggggcaaaaaagcatacgagagactgctgtggaacggcaagtactacaactac
gacagtagcactagcaagtatcacaacagcataatggcggaccagttatctggacagtgg
tacctgcacgcctgcgacctggcccaaacatctaatgaccgggttttcccgagtgagaat
gtaatcagtgccctgagaacagtgtttaacttcaacgtgatgaaattccaggagggaaca
atgggcgctgtgaatggcattaggcctgatggacagcttgacacaagtagtcttcaagcc
gaggaggtctggaccggggtgacgtatgcggtagcggcatctatgatacaggaggggctg
gttgatgaaggttttaaaacggcaagcggtatctacaatacgtgcttcgagcgattaggc
atgaacttccagacccctgaagccatcgttgccaatggcaactaccggtcattagcatat
atgcgaccgctgagcatttgggcgatgcagtgggcgctggagaagaggaaaaacaagagg
gagtcatca

DBGET integrated database retrieval system