KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g195312Help
Entry
NEMVE_v1g195312   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Enzymes [BR:nve01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     NEMVE_v1g195312
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 688 aa AA seqDB search
METEMIKAVRLEYIRLREKRQMKRKESAKRDFIANRQKIREQLRKRKQKIENVTSCPIVG
SALLTEQMQRPARKCTASSGFHHSTQHTLLRTMCAVTPIPNFFTWSPLQQNFVVEDETVL
HNIPYMGEDVIEKDNSFIEELIKNYDGKVHNTRMLDDYTLTDDLLVELIDGVLATSSNVA
KEPDPQETKGTETKDGQSGATDSQAVVPSDALFEAIIKLFPEKSWKLVDIKSRYNDAKTR
IEGHAPPECTPNIDSPEAQSVSREQSLHSFHMLFCRRCYKYDCFLHGWRSFPSQAKRKSP
VDLQESSPCGPDCWLHIKNVAVSPSGSPSKSESSSRKRSKGRKSSQHSQGFPSPDSASPT
KKSADELLSQQSEWSGAEASLLRVLRTVYFNNYCTIAKLIETKTCKEVYFRAFGESEESL
PVVDDTNTPPRKRKRKHRMWSLHCRKIQLKKDSTSTHVYNYIPCDHPGLPCDQSCLCVMT
QNFCEKFCQCNSDCQNRFPGCRCKAQCNTKQCPCFLAVRECDPDLCGTCGADNFDQDSKT
CKNVSLQRGQRKHMLLAPSDVAGWGIYIKQSVKKNEFISEYCGEVISQDEADRRGKVYDK
YMCSFLFNLNNDFVVDATRKGNKIRFANHSISPNCYAKVMMVNGDHRIGIFAKRDIEAGE
ELFFDYRYSATDALKFVGIERDVDFALR
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggagacggaaatgataaaagctgttcgtctagaatacatcagacttcgtgagaaacga
cagatgaagcgaaaggagtccgcgaagagggactttattgccaacaggcagaaaattcga
gagcagctgcgtaaacggaaacagaaaattgagaatgttacatcttgtcctatagtagga
tctgcattattgacagagcaaatgcaacgccctgctcgtaagtgtactgctagcagcggc
tttcatcattccacccaacacaccctactgcgcactatgtgtgctgtgacgccaatacca
aacttctttacctggtctcccctccagcagaactttgtggttgaggatgagactgttctt
cacaatattccatatatgggagaagatgtcattgagaaagacaattccttcatcgaagaa
ctcatcaagaactatgatggcaaagtacacaatacacgaatgctggatgactatactttg
acagatgatttactagtggagctgattgatggtgttcttgcgacttcaagcaatgtggca
aaggaaccagacccccaagagaccaagggaacagaaacaaaggatgggcaaagcggggcc
actgattcacaagctgttgtcccatctgatgccttgtttgaagccataataaagttgttt
cctgaaaaatcatggaaattggtggacatcaaatcaagatacaatgatgcaaaaactcgg
atagagggtcatgcccccccagaatgcacccctaacatcgacagccctgaggcacagtct
gtttcacgagagcaaagcttgcattcatttcatatgttgttttgtcgtcgatgctacaag
tatgactgctttctccatggatggcgatcatttccaagtcaagctaaaagaaagagccca
gtggatctccaggagtcttctccctgtgggcctgactgttggttacatattaagaatgtg
gctgtgagtccttcaggctctcctagcaagtcagagtcctcttctcgcaagagaagcaaa
ggaaggaagagtagccagcattcccaaggcttcccgagtcctgactctgccagtccaacc
aagaaaagtgcagatgagctgctctcccagcagtcggaatggagcggcgcagaagcctcc
cttcttcgtgtcctgcgtacggtctacttcaataactactgtaccatagccaaacttata
gagacaaagacatgcaaggaggtctacttccgtgcatttggtgaatcagaggagagtctg
ccagtggtagatgacaccaacacgcctcccaggaaacgaaagcggaagcacagaatgtgg
tctctccattgccgaaaaattcagctcaagaaagatagcacatctacacacgtgtacaac
tacatcccctgcgaccatcctggacttccatgtgatcagtcctgtctatgtgtaatgaca
cagaacttctgtgagaagttttgccagtgcaactctgattgccagaaccgctttcctggg
tgccgatgcaaagctcagtgtaataccaagcagtgcccatgctttttggcagttcgcgag
tgcgaccctgacctttgtggcacatgtggtgccgataattttgatcaggactctaagact
tgtaagaatgtgagcctacaacgtggacagcggaagcacatgctgcttgctccgtcagat
gtagcgggatgggggatatacatcaaacaatcagtcaagaagaatgaatttatcagcgag
tattgtggcgaggttatttctcaagacgaagcagatagaaggggcaaggtttatgacaaa
tacatgtgtagtttcctgttcaatttgaataatgattttgtggtggatgccactcgaaaa
gggaacaagatccgcttcgctaaccactcgatcagcccaaactgctatgcaaaggtgatg
atggtgaatggagatcatcgcatcgggatcttcgccaagcgcgatatcgaggctggagag
gaactcttctttgattaccgatacagcgcaacggacgctctcaagttcgtcggtattgag
agagatgtggactttgctttaaggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system