KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g195800Help
Entry
NEMVE_v1g195800   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00062  Fatty acid elongation
nve00071  Fatty acid degradation
nve00280  Valine, leucine and isoleucine degradation
nve00310  Lysine degradation
nve00380  Tryptophan metabolism
nve00410  beta-Alanine metabolism
nve00640  Propanoate metabolism
nve00650  Butanoate metabolism
nve01040  Biosynthesis of unsaturated fatty acids
nve01100  Metabolic pathways
nve01200  Carbon metabolism
nve01212  Fatty acid metabolism
Module
nve_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
nve_M00085  Fatty acid biosynthesis, elongation, mitochondria
nve_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NEMVE_v1g195800
   00650 Butanoate metabolism
    NEMVE_v1g195800
  Lipid metabolism
   00062 Fatty acid elongation
    NEMVE_v1g195800
   00071 Fatty acid degradation
    NEMVE_v1g195800
   01040 Biosynthesis of unsaturated fatty acids
    NEMVE_v1g195800
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NEMVE_v1g195800
   00310 Lysine degradation
    NEMVE_v1g195800
   00380 Tryptophan metabolism
    NEMVE_v1g195800
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NEMVE_v1g195800
Enzymes [BR:nve01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     NEMVE_v1g195800
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     NEMVE_v1g195800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N 3HCDH
Motif
Other DBs
NCBI-GeneID: 5499345
NCBI-ProteinID: XP_001620960
JGI: 195800
UniProt: A7T5A3
AA seq 406 aa AA seqDB search
MDQHKSSVAVLGAGLMGAGVVQVSLQKFPHVIMKDNVIEGLARGTQQIYKGLNSKVKRRT
ISSFERDRILSSLDGQIDYKGFEKADMVIEAVFEDLGIKHKVIKEVEQYIPEHCVFASNT
SSLPITQIAEASKRPEKVIGMHYFSPVDKMPLLEIITTEKTSKDTCAAAVSVGLKQGKTV
ITVKDGPGFYTTRILAPALAEAVALLQEGVGPKQLDSLSKQFGFPVGSVTLADEVGLDVA
CHVAEDLEKALGARLGGADINVLKSLVAGGNLGRKSGKGFFVYGKGKRTVSEEAMQILKE
HSVAKKGSHSNEEIQMRLAGRFINEAVMCLQEGILANPVDGDIGAVFGLVFPPFHGGPFR
FLDSYGAGKFVSRMQELQSSIGEVQFAPCQMLLDYAKDPSKKFHKS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggaccaacataaaagctctgttgctgttcttggcgctggtttgatgggtgctggtgtt
gtgcaggttagtcttcagaagttcccgcatgtcatcatgaaggacaatgtcattgaaggc
ctagcacgtgggacacagcaaatttataaaggattaaacagtaaagtgaagagaagaacc
atctcaagctttgagagagatcggatcctgtctagtttggatggtcagatagactacaag
ggctttgaaaaagctgatatggtcattgaagctgtttttgaggaccttggcattaaacat
aaagttatcaaagaagtagaacagtatattcctgagcactgtgtcttcgcatcaaacacc
tcatcactccccataacacagatcgctgaagctagcaaaagaccagagaaggtgattggt
atgcattatttctcccctgttgacaaaatgccattgcttgagataatcaccacagagaag
acttcaaaggacacttgcgctgctgcagtcagcgttggtttgaaacaaggcaagaccgta
atcacagtcaaggatggacctgggttctacaccacccgcattctcgccccagccctggct
gaggcagttgccctactgcaggagggagtgggtcccaagcaactggattccctgtccaaa
cagtttgggttccctgtgggaagtgtcacgctagccgatgaggttggtctggatgttgct
tgtcacgtcgctgaagacttggagaaggctctaggagccaggctcggaggagcagacatc
aatgtactcaagtcgctcgtggcgggcggcaacctgggacgaaaatcaggcaagggcttc
tttgtctatggcaagggcaaacgtacagttagcgaagaggcgatgcagatcctgaaggaa
cactcagtggcgaagaaaggcagccacagcaatgaggagatccagatgcgacttgcagga
aggtttatcaatgaggctgtcatgtgcctgcaagaaggcatcctcgcaaacccggttgat
ggcgacatcggtgccgtctttggactggtattcccacctttccacggaggtccattccgc
ttcttggactcgtacggcgccggcaagttcgtctcccgaatgcaagagctgcagtcgtcc
ataggcgaggttcagttcgctccgtgccagatgctacttgactatgctaaggacccctcc
aagaaattccacaagagctag

DBGET integrated database retrieval system