KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g195800Help
Entry
NEMVE_v1g195800   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NEMVE_v1g195800
   01212 Fatty acid metabolism
    NEMVE_v1g195800
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NEMVE_v1g195800
   00650 Butanoate metabolism
    NEMVE_v1g195800
  Lipid metabolism
   00062 Fatty acid elongation
    NEMVE_v1g195800
   00071 Fatty acid degradation
    NEMVE_v1g195800
   01040 Biosynthesis of unsaturated fatty acids
    NEMVE_v1g195800
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NEMVE_v1g195800
   00310 Lysine degradation
    NEMVE_v1g195800
   00380 Tryptophan metabolism
    NEMVE_v1g195800
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NEMVE_v1g195800
Enzymes [BR:nve01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     NEMVE_v1g195800
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     NEMVE_v1g195800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 406 aa AA seqDB search
MDQHKSSVAVLGAGLMGAGVVQVSLQKFPHVIMKDNVIEGLARGTQQIYKGLNSKVKRRT
ISSFERDRILSSLDGQIDYKGFEKADMVIEAVFEDLGIKHKVIKEVEQYIPEHCVFASNT
SSLPITQIAEASKRPEKVIGMHYFSPVDKMPLLEIITTEKTSKDTCAAAVSVGLKQGKTV
ITVKDGPGFYTTRILAPALAEAVALLQEGVGPKQLDSLSKQFGFPVGSVTLADEVGLDVA
CHVAEDLEKALGARLGGADINVLKSLVAGGNLGRKSGKGFFVYGKGKRTVSEEAMQILKE
HSVAKKGSHSNEEIQMRLAGRFINEAVMCLQEGILANPVDGDIGAVFGLVFPPFHGGPFR
FLDSYGAGKFVSRMQELQSSIGEVQFAPCQMLLDYAKDPSKKFHKS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggaccaacataaaagctctgttgctgttcttggcgctggtttgatgggtgctggtgtt
gtgcaggttagtcttcagaagttcccgcatgtcatcatgaaggacaatgtcattgaaggc
ctagcacgtgggacacagcaaatttataaaggattaaacagtaaagtgaagagaagaacc
atctcaagctttgagagagatcggatcctgtctagtttggatggtcagatagactacaag
ggctttgaaaaagctgatatggtcattgaagctgtttttgaggaccttggcattaaacat
aaagttatcaaagaagtagaacagtatattcctgagcactgtgtcttcgcatcaaacacc
tcatcactccccataacacagatcgctgaagctagcaaaagaccagagaaggtgattggt
atgcattatttctcccctgttgacaaaatgccattgcttgagataatcaccacagagaag
acttcaaaggacacttgcgctgctgcagtcagcgttggtttgaaacaaggcaagaccgta
atcacagtcaaggatggacctgggttctacaccacccgcattctcgccccagccctggct
gaggcagttgccctactgcaggagggagtgggtcccaagcaactggattccctgtccaaa
cagtttgggttccctgtgggaagtgtcacgctagccgatgaggttggtctggatgttgct
tgtcacgtcgctgaagacttggagaaggctctaggagccaggctcggaggagcagacatc
aatgtactcaagtcgctcgtggcgggcggcaacctgggacgaaaatcaggcaagggcttc
tttgtctatggcaagggcaaacgtacagttagcgaagaggcgatgcagatcctgaaggaa
cactcagtggcgaagaaaggcagccacagcaatgaggagatccagatgcgacttgcagga
aggtttatcaatgaggctgtcatgtgcctgcaagaaggcatcctcgcaaacccggttgat
ggcgacatcggtgccgtctttggactggtattcccacctttccacggaggtccattccgc
ttcttggactcgtacggcgccggcaagttcgtctcccgaatgcaagagctgcagtcgtcc
ataggcgaggttcagttcgctccgtgccagatgctacttgactatgctaaggacccctcc
aagaaattccacaagagctag

DBGET integrated database retrieval system