KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g196099Help
Entry
NEMVE_v1g196099   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:nve00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NEMVE_v1g196099
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    NEMVE_v1g196099
Translation factors [BR:nve03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    NEMVE_v1g196099
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 183 aa AA seqDB search
MKHPLQNRWVLWFFKNDKSKSWAANLRNITSFDTVEDFWGIYNHIQQASRLQPGCDYSLF
KDGIEPMWEDKRNKDGGRWLINTNKNQRQSDLDRFWLETLLCLIGEAFGEYSEGVCGAVV
QIRNKGDKIAVWTGNATDEEGTRRIGQVFKERLGLPPKMFIGYQAHQDTMTKTGSTTKSL
FSV
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatccacttcagaatcgatgggtcttatggttcttcaagaatgacaagtccaaa
tcatgggcagctaatttaaggaacattacctcttttgatactgtggaggacttctgggga
atatataaccatatacaacaagcaagcagattacagccaggctgtgactattcattattc
aaggacggaattgaacctatgtgggaagacaagagaaataaggatggtggacgttggctt
ataaacacaaataagaatcagagacagagtgatcttgatagattctggctagagacgctg
ctgtgccttataggagaagcctttggtgaatactctgagggtgtttgtggtgctgttgtc
caaattcgtaacaagggtgacaagattgctgtatggacagggaatgctactgatgaagag
gggacaagaaggatagggcaagtttttaaggaaaggttaggacttccaccaaaaatgttc
ataggatatcaggctcaccaagacacaatgaccaagacaggatccaccacaaagtcccta
ttctcagtatga

DBGET integrated database retrieval system