KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g197607Help
Entry
NEMVE_v1g197607   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00849  
galactokinase [EC:2.7.1.6]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Galactose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, galactose => UDP-galactose
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:nve00052]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nve00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 451 aa AA seqDB search
MLSNLPNSKRYEELQKKFLQKYNGVFPAFFARAPGRVNLIGEHIDYCGYGVLPMALEQDI
VIAACPNTKGILRIANTNPDFKDFSVDNIDYNIDGKEWYHYFLCGYKGIVDRVPILDPVG
MNVLVDGNVPNSAGLSSSSALVCCSCLATLHVNTLELSKTELAEVCTKCERYIGTEGGGM
DQAISFLAEPGTAKHIEFNPIRAFDVTLPDGLAFVIANSLGEMKKSTSAGTHFNVRVVEC
RLAAKVLAKSKGLDWQKIRRLSEVQDALGVSLDEMVTIVESTLHSEAYTKEELCKFFELS
DAELVTKCMSESTAAVTSFKLHDRSKHVYSEAARVLKFKEVCKTKPQDAAQVLGELMNGS
FKSCSELYECSCEELNTLVTICRKAGALGSRLTGAGWGGCTVSMVREQDVDDFIAKVTKE
YYSTPARQERVSEALFATRPGSGAALVCLND
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgttatcaaatctaccaaactcaaagagatatgaggaactccagaaaaagtttttgcag
aagtataatggtgttttcccagcattctttgcaagagcaccaggcagggtcaaccttatt
ggtgaacacatcgactactgtgggtatggcgtgttgccgatggctctagagcaagacatt
gtcattgctgcatgtcccaacactaaaggaattcttcgcattgctaacaccaatccagat
ttcaaggatttcagtgtggataacattgattacaacatcgatggcaaggagtggtatcat
tacttcctctgtggatataagggaattgttgaccgagtccctatactcgacccagttgga
atgaacgtcttggttgatggtaacgtaccaaacagtgcaggtctgtctagctcatctgct
cttgtttgctgctcctgtctggcgacgcttcatgttaacacattggagcttagcaagacc
gagcttgcagaagtgtgtacaaagtgcgagaggtacattgggactgagggcggtggcatg
gatcaagcaatctcatttcttgctgaacctggaactgcaaagcatatagaatttaaccct
atcagggcctttgacgtcactctgccagatggacttgcctttgttatcgccaacagcctg
ggggaaatgaagaagtcaacctctgcagggacacattttaatgtgcgtgtggtagaatgc
cggcttgctgccaaggttttagcaaaatccaaaggactagattggcagaaaatccgccgc
ctgagtgaagtacaagatgctcttggtgtgagtcttgatgaaatggtgactattgtggaa
tcaactcttcacagtgaagcatacaccaaggaggagctttgtaaattttttgaattgagt
gatgcagagctggtaacaaagtgtatgagtgagtcaacagctgctgtaaccagctttaag
ttacatgaccgatcaaagcatgtctactcagaggcagcgagggttctcaagtttaaagaa
gtctgcaaaaccaaacctcaggatgccgcacaggtccttggagagttgatgaacggcagt
tttaagagttgtagcgagctgtatgagtgtagctgcgaggagcttaacaccctagtgact
atctgcaggaaagcgggtgccctgggttctcgcctgaccggggcgggctggggcggctgc
actgtatccatggtccgtgaacaagatgtggatgacttcatcgcgaaggtcaccaaagag
tactactccacccctgcccgtcaggagcgagtctcggaggcgctgtttgcgaccaggcct
ggtagtggagcggctcttgtctgtctcaatgattga

DBGET integrated database retrieval system