KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g197607Help
Entry
NEMVE_v1g197607   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K18674  
N-acetylgalactosamine kinase [EC:2.7.1.157]
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Enzymes [BR:nve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.157  N-acetylgalactosamine kinase
     NEMVE_v1g197607
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 451 aa AA seqDB search
MLSNLPNSKRYEELQKKFLQKYNGVFPAFFARAPGRVNLIGEHIDYCGYGVLPMALEQDI
VIAACPNTKGILRIANTNPDFKDFSVDNIDYNIDGKEWYHYFLCGYKGIVDRVPILDPVG
MNVLVDGNVPNSAGLSSSSALVCCSCLATLHVNTLELSKTELAEVCTKCERYIGTEGGGM
DQAISFLAEPGTAKHIEFNPIRAFDVTLPDGLAFVIANSLGEMKKSTSAGTHFNVRVVEC
RLAAKVLAKSKGLDWQKIRRLSEVQDALGVSLDEMVTIVESTLHSEAYTKEELCKFFELS
DAELVTKCMSESTAAVTSFKLHDRSKHVYSEAARVLKFKEVCKTKPQDAAQVLGELMNGS
FKSCSELYECSCEELNTLVTICRKAGALGSRLTGAGWGGCTVSMVREQDVDDFIAKVTKE
YYSTPARQERVSEALFATRPGSGAALVCLND
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgttatcaaatctaccaaactcaaagagatatgaggaactccagaaaaagtttttgcag
aagtataatggtgttttcccagcattctttgcaagagcaccaggcagggtcaaccttatt
ggtgaacacatcgactactgtgggtatggcgtgttgccgatggctctagagcaagacatt
gtcattgctgcatgtcccaacactaaaggaattcttcgcattgctaacaccaatccagat
ttcaaggatttcagtgtggataacattgattacaacatcgatggcaaggagtggtatcat
tacttcctctgtggatataagggaattgttgaccgagtccctatactcgacccagttgga
atgaacgtcttggttgatggtaacgtaccaaacagtgcaggtctgtctagctcatctgct
cttgtttgctgctcctgtctggcgacgcttcatgttaacacattggagcttagcaagacc
gagcttgcagaagtgtgtacaaagtgcgagaggtacattgggactgagggcggtggcatg
gatcaagcaatctcatttcttgctgaacctggaactgcaaagcatatagaatttaaccct
atcagggcctttgacgtcactctgccagatggacttgcctttgttatcgccaacagcctg
ggggaaatgaagaagtcaacctctgcagggacacattttaatgtgcgtgtggtagaatgc
cggcttgctgccaaggttttagcaaaatccaaaggactagattggcagaaaatccgccgc
ctgagtgaagtacaagatgctcttggtgtgagtcttgatgaaatggtgactattgtggaa
tcaactcttcacagtgaagcatacaccaaggaggagctttgtaaattttttgaattgagt
gatgcagagctggtaacaaagtgtatgagtgagtcaacagctgctgtaaccagctttaag
ttacatgaccgatcaaagcatgtctactcagaggcagcgagggttctcaagtttaaagaa
gtctgcaaaaccaaacctcaggatgccgcacaggtccttggagagttgatgaacggcagt
tttaagagttgtagcgagctgtatgagtgtagctgcgaggagcttaacaccctagtgact
atctgcaggaaagcgggtgccctgggttctcgcctgaccggggcgggctggggcggctgc
actgtatccatggtccgtgaacaagatgtggatgacttcatcgcgaaggtcaccaaagag
tactactccacccctgcccgtcaggagcgagtctcggaggcgctgtttgcgaccaggcct
ggtagtggagcggctcttgtctgtctcaatgattga

DBGET integrated database retrieval system