KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g198581Help
Entry
NEMVE_v1g198581   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:nve03013]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:nve03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 123 aa AA seqDB search
GVRKRPPRKDVKKKNDVYVNRRSDFAGQLERCQKLLDSSHQEVWIHGLGAAINRAINLSL
QLKQRGMGSVEVSPKTSSVQLVDDLEPENDEDERHTRTRTNSAIHIRVYRIPLNPTEQSK
EAS
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
ggtgttaggaaaagaccaccgagaaaagacgtgaagaagaaaaatgacgtttacgttaac
cgtagatctgacttcgcgggacaactcgaacgatgccaaaaacttctcgattcaagccac
caggaggtgtggattcatggccttggtgccgccatcaacagagctatcaacttatcctta
caactcaaacagcgtggaatgggaagtgttgaggtttctccaaaaacctcaagcgtgcag
ttggtagatgaccttgagccagagaatgatgaagatgaacggcacactcggaccaggaca
aactctgcaatccatatcagagtgtacagaattccattaaatccaacagagcaaagcaaa
gaagcaagctaa

DBGET integrated database retrieval system