KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g198581Help
Entry
NEMVE_v1g198581   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:nve00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NEMVE_v1g198581
   03008 Ribosome biogenesis in eukaryotes
    NEMVE_v1g198581
Enzymes [BR:nve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     NEMVE_v1g198581
Ribosome biogenesis [BR:nve03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     NEMVE_v1g198581
Transfer RNA biogenesis [BR:nve03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    NEMVE_v1g198581
Mitochondrial biogenesis [BR:nve03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    NEMVE_v1g198581
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 123 aa AA seqDB search
GVRKRPPRKDVKKKNDVYVNRRSDFAGQLERCQKLLDSSHQEVWIHGLGAAINRAINLSL
QLKQRGMGSVEVSPKTSSVQLVDDLEPENDEDERHTRTRTNSAIHIRVYRIPLNPTEQSK
EAS
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
ggtgttaggaaaagaccaccgagaaaagacgtgaagaagaaaaatgacgtttacgttaac
cgtagatctgacttcgcgggacaactcgaacgatgccaaaaacttctcgattcaagccac
caggaggtgtggattcatggccttggtgccgccatcaacagagctatcaacttatcctta
caactcaaacagcgtggaatgggaagtgttgaggtttctccaaaaacctcaagcgtgcag
ttggtagatgaccttgagccagagaatgatgaagatgaacggcacactcggaccaggaca
aactctgcaatccatatcagagtgtacagaattccattaaatccaacagagcaaagcaaa
gaagcaagctaa

DBGET integrated database retrieval system