KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g199909Help
Entry
NEMVE_v1g199909   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NEMVE_v1g199909
Enzymes [BR:nve01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     NEMVE_v1g199909
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 208 aa AA seqDB search
MNVSDVPQLEKRATDEATVGKEVAAISKAYETILSNIGEDKDRQGLLKTPERAAKAMLYF
TKGYEEKVQEILNDAVFDEDHDELVIVKDIEMFSLCEHHLVPFMGKVHIGYLPNKKIVGL
SKLARLVEMFSRRLQVQERLTKQIAMAIVEAVNPAGVGVVIEAKHMCMVMRGVQKPSSET
VTSCMLGVLREDPRSRDEFLTLIHKRKL
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtctcagacgtaccccaacttgaaaagcgtgcaaccgatgaagccactgtgggc
aaagaagtggccgcaatttctaaagcatatgaaactattttgagtaatatcggagaagat
aaagaccgccaagggctacttaagaccccagaaagagcggcaaaggcaatgctgtatttc
acgaaaggttacgaagagaaagttcaagagattcttaatgatgcagtgtttgatgaagat
catgatgagctagtcattgtcaaagacattgagatgttttctttgtgcgagcaccatcta
gttccgtttatggggaaggtgcatattggatatttgccaaacaagaaaattgttggattg
agtaagctagcaaggcttgttgaaatgtttagcaggagattacaagtccaagaaaggctc
accaaacagattgccatggcgattgtcgaggctgtcaatccagcaggagtgggtgttgtc
atagaggcaaaacacatgtgtatggtgatgaggggcgtgcagaaaccaagtagtgaaaca
gtcactagttgtatgttaggagttctaagagaagaccctagatcaagggacgaattcctg
actctcattcataaaagaaaattataa

DBGET integrated database retrieval system