KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g199933Help
Entry
NEMVE_v1g199933   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NEMVE_v1g199933
Enzymes [BR:nve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     NEMVE_v1g199933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 326 aa AA seqDB search
MAGHKGHFDVVVVGSCMTDLVSYVPRLPKAGETIHGSKFSMGFGGKGANQCVMASRLGAK
SAMVAKVGDDSFGHSTIENFKQNKVNVDHVTLTKKAFTGVAPISVNNGGENSITIVSGAN
EYLDEDDIKRARSMIVSASVVVCQLEIQPDITQLALALARNANVTTVFNPAPASAWLDTQ
FYRLSDVFCANESEAELLTGLPVKSIDDAEKAVVMLLERGAGRVIITLGAKGSVIGSQQN
PMPLHIPVTPSEAVDTTGAGDAFIGALAFYLAKFKNLSFKEMVIRASEVARMTVFKEGTQ
TSFPFKETIPSSFFAQSSSGDRKTIR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcgggacataaaggccacttcgacgtcgttgtcgttggctcttgtatgactgattta
gtcagctacgttccgcgtcttcccaaagctggcgaaaccattcacggatcaaagtttagt
atgggcttcggcggtaaaggagccaaccagtgtgtgatggcttcaaggctaggggcaaag
tctgcaatggtagctaaggttggagatgactcatttggacacagtactatagagaacttc
aaacaaaacaaagtgaatgttgatcatgtcaccttaaccaagaaagcatttactggtgta
gctccaatttcagttaacaatggaggtgaaaattctataacaatagtaagtggagcaaat
gagtaccttgatgaagatgatatcaagcgagcaagatccatgattgtgtcggcatcagtc
gttgtttgtcaactagaaattcaaccagatattactcaacttgctttggctcttgcaagg
aatgctaatgtcaccactgtattcaatcctgccccggcgtcagcgtggctagacactcag
ttctacagacttagtgatgtattttgtgcaaatgagagtgaggctgaactattaactggc
ctgccagtcaaatcaatagatgacgctgagaaagcagtggtgatgttgttagagcgtgga
gcaggaagggtgatcatcactttaggtgctaaagggtctgttattggatcccagcaaaac
cccatgcctcttcacatcccggtgacaccatcagaagcagtggatacaacgggagctgga
gatgcgtttattggggcattggcattttacctggccaagttcaaaaacttatcgttcaag
gaaatggtcatacgtgctagcgaagtcgccagaatgacagttttcaaagaaggaacccag
acgagttttccgttcaaagagaccattccctcgtcatttttcgcccaatcttccagtgga
gaccggaaaaccattagatga

DBGET integrated database retrieval system