KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g200667Help
Entry
NEMVE_v1g200667   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
nve  Nematostella vectensis (sea anemone)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 551 aa AA seqDB search
MDGKTASTDLLPPLKPSTKANLKHQSHDGTNGGGTLPHLGSIQVQQLFEEETNNKLQGKS
MPVVHDHGLPSVSRTGRSPSVIERRQSSNSTGSQKSRSFTAEVAMKQYMHKLSGYETHEI
FNYSQIYFVGEAAKKRQGVVGGANNCGYDDEQGSYIHVPKDHIAYRYEVLKIIGKGSFGQ
VVKALDHKTNTHVALKMVRNEKRFHRQAQEEIRILEHLKKQDKDNTHNIIHMLEHFTFRN
HVCMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENIL
LKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGARYGMPIDMWSFGCILAEL
LTGYPLFPGEDEGDQLACNMELLGYIPEKLRETSKRAKNFINSKGYPRYCTITTLPDGSV
AVSGGRSRRGKTRGAPNSKTFVQALKGCDDAMFIDFLKRCLEWDPSARMTPSQALRHPWL
RRRALPRAPESNNNLASATSTEKRRSAVGKFPPTGPSSGKNKPRRPIEIGEDVNDSASLN
TRTVLPKIAGR
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggatggaaaaaccgcgagtacggatttgttacctccactcaagccgtcaacaaaagca
aatttaaaacaccaaagtcacgatggtacgaatggagggggaactttaccgcatttggga
agtattcaagtgcaacagttattcgaagaggagacgaataacaagcttcagggaaaatcg
atgcctgtagtccatgaccatggtctaccatcggtttctaggacgggacgctcaccctca
gtgatagagcgaagacaaagcagtaacagcacaggctcgcaaaagagtcggtctttcaca
gcagaggtggctatgaagcaatatatgcacaagctatctggctacgagacccacgagatc
ttcaattattcgcaaatttattttgtcggcgaggctgcaaagaaacggcaaggtgtggtt
ggtggcgcaaataattgtggatatgacgacgagcaaggttcatatatccatgttcctaaa
gaccacatcgcctacaggtacgaagttctcaagattatcggtaaaggaagctttggacaa
gttgtgaaggcactcgatcacaagactaacacgcacgtagctttgaaaatggtacgaaac
gagaaacgctttcatcggcaagcacaagaagaaattcggatcttagaacatctgaagaaa
caagacaaggacaacacgcataatataattcacatgttggaacatttcacatttaggaac
catgtctgtatgactttcgaacttctaagtatgaatctctacgagctaattaagaagaac
aaattccaagggtttagtttaccattggtacgcaagtttgctcactcgattcttcaatgt
ttagacgctttgcacaaaaaccgcataattcattgtgacttgaaaccggaaaatattcta
cttaaacagcaaggaagaagtggaataaaggttattgacttcggatcgagttgttacgaa
caccagagaatttacacatacatccagagtaggttttaccgagcaccggaggtcatctta
ggggcacgctacggtatgcctatcgatatgtggagctttggttgtatacttgctgaactt
ttaactggctacccgttgttcccgggagaagatgaaggcgaccaacttgcttgtaacatg
gaactgcttggttatatcccagaaaagttaagagagacctccaaacgagcgaagaacttc
ataaactctaaaggttatccccgatactgtactatcacaacactacctgacggaagcgtt
gctgttagcggaggtcgttcgcggcgcggtaaaaccagaggtgcaccaaactccaagacc
tttgtacaggctctcaaaggatgcgacgatgctatgtttatcgatttcttgaagagatgt
ctagaatgggaccctagtgctcgtatgacgccgtcccaagctttacgacatccgtggtta
agacgaagagccttgccacgggcccccgaaagtaacaataacttggcttccgctacttcg
accgagaaacgtcgatccgcggtaggaaagtttccacctacgggaccatcttctggaaaa
aacaagccacggagacccatagagatcggggaagatgtgaacgactctgcttcgctaaac
acaagaactgtacttccgaaaatcgcagggaggtag

DBGET integrated database retrieval system