KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g200699Help
Entry
NEMVE_v1g200699   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    NEMVE_v1g200699
Enzymes [BR:nve01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     NEMVE_v1g200699
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 874 aa AA seqDB search
MAQLKIAIIGQSQFGLEVYRNLRIKGHEIVGVFTVPDIKGKPDILAAGAEEDGVKVFKFP
RWRTKGEPIAEVVDKYKACGAELNVMPFCSQFIPMNVIDFPKHGSIIYHPSLLPRHRGAS
AINWTLMEGDKKAGFSIFWADDGLDTGPILLQKSIQVDPNDTVDTLYNRFLYPEGIKGMV
EAVELIANGKAPRITQPEEGATYDKIWKKKEVAKINWNQNAATLHNFIRGNDKLPGAWAL
INGEEVTFYGSKLGPKGKTPKGCEVEIDGLDRPAIVHKDGMTIIGSDEKMLTVKTLQLAG
GRMIEASKYGQEEEHMAPLELNEEETAIEGKLKAIWAGILANPDINEETDFFNAGAGSMD
VARLVEEVKQKCGVVIEPEEIDMDVNYMTIHMPHQLFINGEFVDSHHGKTFNTINPTDGT
VLAQVSLATHEDVDDAVDAAKEAFYNGPWGSMNARDRATLMNRLADLMEQHKEELATIES
LDSGAVYTLALKTHVGMSIDTVRYFAGWCDKIQGLTVPVNNAKPNRNLCYTKREPIGVCG
LIVPWNYPLMMLAWKISPLLAAGNTVVLKPAQVTPMTALKFAELAARAGFPKGVINILPG
SGSVVGNRICEHPDVRKLGFTGSTPVGKAIMESCATSNLKKCSLELGGKSPLIIFSDCDM
ERAVRQGMMACLFNKGENCIAAGRLFVEESIHDEFVNRLVDELKKLKIGDPLDTATDHGP
QNHKAHLDSLVEYVKRGVEEGAKLVYGGRHLDRPGFFFEPAVFTNVEDDMFIAKEESFGP
VVIISKFDDGDVEGVLESANGTEYGLASGVFTKDMSKALRVADALEAGTCFVNTYNKTDV
AAPFGGCKQSGFGKDLGMEALNEYLKTKVITIEY
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagctcaagattgctatcatcggacagtcgcagtttggcttggaagtgtacagg
aacttacgaattaaagggcacgaaattgttggtgtgtttacggtaccggatatcaaaggg
aaaccggatatattagcagcaggtgcagaggaagatggggtaaaagtgttcaagttcccg
cgatggagaacgaaaggcgaaccgattgcagaagtagtggacaagtacaaagcttgcggc
gccgagctgaatgttatgccgttctgttctcagttcattccaatgaatgtcattgacttt
ccaaagcatggctccattatctatcacccttccttgctaccaagacatcgtggggcttct
gctattaactggactcttatggagggtgataaaaaagctggcttctcaatattttgggca
gacgatggcctagacacaggacctattcttcttcaaaaaagtattcaagtcgaccccaat
gacacagttgatactctgtacaacagatttctctatcccgagggtatcaaaggcatggtt
gaggctgtagagctgattgctaacgggaaagccccccgtataacacagccagaggagggc
gctacatatgacaaaatctggaaaaagaaagaagttgcaaagataaactggaatcagaat
gctgctactctccataactttataagagggaatgacaagctgccaggagcctgggcccta
ataaatggggaggaagtgacattctatggctctaaattggggccaaagggcaagactccg
aaaggctgcgaggttgaaattgacggccttgatcgccctgccattgttcacaaggatggc
atgacaatcattggctctgatgaaaagatgcttactgtaaaaacactccaacttgctggt
ggccggatgattgaagcgtccaaatacggccaggaggaagaacacatggctcctctggag
ctgaatgaggaggagacagcaatagagggaaagctgaaagccatttgggcaggtattcta
gcaaaccctgatattaatgaagagactgacttcttcaatgcaggggctggttctatggat
gttgcaaggcttgttgaggaagtaaaacaaaagtgtggggttgttattgaaccagaggag
attgacatggacgtaaactacatgactattcacatgccacaccagctgtttattaatggg
gagtttgtggattctcatcacggaaaaaccttcaacacaatcaaccccacggatggaact
gtcttggcacaagtatccctcgcgacacatgaagatgttgacgatgctgttgatgctgca
aaggaagcattttataatgggccttggggatccatgaatgcaagagacagagcaactctc
atgaacaggcttgcagacctgatggaacaacataaagaggagttagctacgatagagtct
ctagattccggtgctgtgtacaccctggcccttaagacacatgtgggcatgtctattgac
accgtcagatactttgctgggtggtgtgataagattcagggcctcactgtccctgtgaac
aatgccaagccaaacagaaacctttgttacaccaaacgtgagccaattggggtatgtggt
ctcattgtaccatggaactacccccttatgatgctggcatggaaaataagtcccttgctt
gcagcagggaatactgtggtcctcaaaccagcacaggttacacccatgactgctctgaag
tttgcagagcttgcagctcgtgctggtttccctaagggtgttataaatattctgcctggt
tcaggctcagttgttggaaatcgtatctgtgaacaccctgacgtacgcaaacttggtttt
actggttcaactcctgttggaaaagcaatcatggaaagctgtgctaccagtaacctgaag
aagtgctccctggagcttggggggaaatcgccgttgatcatcttcagtgactgtgacatg
gagagggcagtcaggcagggaatgatggcatgtctcttcaacaaaggagaaaactgcatt
gctgctggtcggctttttgtagaagaatcaatccatgatgaatttgtcaatcgactggtt
gacgaacttaaaaagctgaaaattggagatcccctggatactgccactgatcatgggcca
cagaaccacaaagctcacctcgattcgctggtggagtacgtgaagcgaggagtggaggaa
ggcgccaagctagtctatggtgggaggcaccttgacaggccaggcttctttttcgagcct
gccgtgttcaccaacgtggaggacgacatgttcattgccaaagaagaatcttttggccca
gtggtcatcatctccaagtttgatgatggagacgtggaaggcgtgttggaaagtgctaac
ggcaccgagtatggccttgcgtctggcgtctttactaaggatatgagcaaggctcttcgt
gttgctgacgcccttgaggctggtacatgttttgtgaacacgtacaacaagacggacgtc
gcggcgccttttggtggctgcaagcagtcaggatttggcaaggatctcggtatggaagcc
ctgaatgaatatttaaagacgaaagtgatcacgattgagtattag

  All links  
No link information was found.   
DBGET integrated database retrieval system