KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g20079Help
Entry
NEMVE_v1g20079    CDS       T01037                                 

Definition
hypothetical protein
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    NEMVE_v1g20079
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NEMVE_v1g20079
   00640 Propanoate metabolism
    NEMVE_v1g20079
  Lipid metabolism
   00061 Fatty acid biosynthesis
    NEMVE_v1g20079
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    NEMVE_v1g20079
Enzymes [BR:nve01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     NEMVE_v1g20079
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     NEMVE_v1g20079
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1093 aa AA seqDB search
VVTPAEFVRKFGGTRVIEKVLIANNGIAAVKCMRSIRRWAYELIGNEKAIKFITMVTPED
LRANAEYIKMADHYSLVPGGSNNNNYANVDLILDVAKRIPVQAVWAGWGHASENPKLPDL
LSKNNITFIGPPAEAMWSLGDKIASTIIAQTVGIPTLPWSGSGLVIENHTEVLEQGGVLT
VPDELYDQASMNEVTDGLKIARSIGYPVMIKASEGGGGKGIRKANNDDEFTNFFRQVQIE
VPSSPIFIMKVAEHSRHLEVQLLVDEYGNAVSLFGRDCSVQRRHQKIIEEAPAAVAKPET
LRKMEEDAINLAKVVGYVSAGTVEYLYNPDDDKYFFLELNPRLQVEHPCTEFIADVNLPA
AQLQVAMGVPLHRIKDIRVLYGKSAYGSDNIVFEPPPPYKKPKGHVIATRITAENPDEGF
KPSSGTVQELNFRSMKDVWGYFSVAASGGLHEYADSQFGHLFAWGEDREDARRNIVLALK
EISIRGDFRTTVEYLIKLLEKDSFKSNRFSTNWLDSLIAEREQTEKPEPILGVIAGAIHV
ADATITKRFANYRDALERGQILPEDCLGNSVDVELIYEGYKYCLTATRLGPNSFFLLMNG
SFVEIETHRLSDGGLLLSFEGHSHTSYMKEQIDSYRMTIGGMTWVFQKQNDPTVLRAPSA
GKLIGYLVEDGGHVFQGETYAEIEVMKMVMPLTVTESGCLHYVKGGGAVLDPGTKVATLE
LDDPSRVTQAQLYTGTFPVSETNSIQKGMKLHQVYQIAKENLQNVMDGYCVDEPYLTPRL
EENVDVLLKSLRNPALPLLELKEMISSIAGRIPLSVEDAIKRHLANYASNLTSLLSQFPS
QQIANVVDAHASTLTKREERDAFFLNTQGIVQLVQRYRNGVRGHLKAVVLALLRKYLQSE
ILFNEGNFEKCVILLRAQSKSKDLSSVVSTVFSHVNVSKKNKLAITLIDRLCGYEPGLSD
ELHSILQELTHLNRQEHAKVALRARQALLASQQPSYERRHNQIESLFLSAVDIMGSQFSP
ESLQKLIYSETAIFDVLPSFFYHKNEAVRKAALEVYVRRSYQAYELTTLYHEMLNENVFI
VEFQFSLPSSHPN
NT seq 3279 nt NT seq  +upstreamnt  +downstreamnt
gtggtcactccagcagaatttgtgaggaagtttggaggaaccagagttattgaaaaggtg
ctgattgcaaacaatggaattgcagcagttaaatgcatgcgttctatccgacgatgggcc
tatgagctcattggtaacgagaaagccatcaagtttatcaccatggtaaccccagaagat
ttacgggccaatgcagaatacatcaaaatggctgatcattactcgctagtacctggcggc
tcaaacaacaataactatgccaatgttgatctgattttggatgttgccaaacgaattcca
gtgcaggctgtgtgggcagggtggggtcatgcttcagaaaatccaaagcttccagacctc
ctctccaaaaataacatcacattcattggtcctcctgcagaagctatgtggtcccttggg
gacaagattgcctctacaatcatcgcccaaactgttggcatacctacacttccctggagt
ggcagcggtctggtgatagaaaaccatacggaagtacttgagcagggaggggtgcttact
gtccctgatgaattgtatgaccaggcatccatgaatgaggtcactgatggactaaagatc
gccagatctattggttatccagtaatgataaaagcatcagaaggtggcggtgggaaagga
ataagaaaagcgaacaatgatgacgagttcacaaacttcttcagacaggtgcagattgaa
gtcccaagctcacctatctttatcatgaaagtcgccgaacattctcgtcaccttgaggtg
caactccttgttgatgagtatggaaatgcggtgtctctttttgggagagactgctccgtt
cagagaaggcatcagaagatcattgaggaagctccagcagctgttgccaaacctgagacc
cttcgcaagatggaggaggatgctattaatcttgcgaaggtagtaggttacgtgagtgct
ggtacagtagagtacctctataatcctgatgatgacaagtacttcttcctggaactcaac
cccagactccaggtggagcacccatgtacagagtttattgccgatgttaaccttccagct
gctcaacttcaggttgctatgggagttcctcttcatcgaatcaaggatatccgagtgctg
tatggcaagtcagcatatggaagtgataacatcgtgtttgagccgcctccaccatacaag
aagcctaaaggtcatgtgattgctaccagaatcacagcagaaaaccctgatgaggggttt
aaaccgagcagtggcacggtgcaagagctgaatttcagaagcatgaaagacgtgtggggg
tactttagcgtggcggcatctggaggcttgcatgagtatgccgactcacaatttggtcac
ctttttgcatggggagaggatagagaggatgctagaagaaatatcgttttagcccttaaa
gaaatctccatccgtggcgacttccgcaccaccgtggaatacttgatcaaacttttagag
aaagattcattcaagagcaacaggttcagcacaaactggctggactcattaatagcagag
cgtgaacagactgagaagccagagcctatccttggagtcatcgccggcgcgatccatgta
gcagatgctaccataacaaagagattcgccaactacagggatgcgcttgagagaggtcag
attctcccggaagattgccttggtaactcagtagatgttgaactcatctacgaaggctac
aagtattgtctgacagccacccgccttggacccaactcattcttcttgctcatgaacggc
tcctttgttgaaatagagactcacagattgagcgatggtgggttgcttctttcttttgaa
ggccacagccacacgtcatacatgaaagagcagattgacagctatcgcatgactattgga
ggaatgacatgggtcttccagaagcaaaacgaccccacggtgctcagagctccttctgct
ggaaagctgattggttaccttgttgaggatggaggtcacgtgttccagggagaaacatat
gcagaaatagaggtgatgaaaatggtcatgcctctcactgtcaccgaaagtggatgtctg
cactatgtcaaaggaggtggggccgttttggatcctgggacaaaggtggctactcttgag
cttgatgatccgagtcgtgttactcaggctcaactttataccggtactttcccagtctct
gaaacgaactccatacagaaaggaatgaagctacatcaagtttatcaaatcgccaaagaa
aacctgcagaatgtgatggacgggtactgtgtggacgagccctatcttacgccaaggctt
gaagagaatgtagatgtgttgctcaagtcattacgcaatccagcccttccgcttcttgag
ctcaaggagatgatatcatctatagccggtcgtatcccactcagtgtggaggatgctatc
aaacgccatttggccaactacgccagcaacctcacttccttactcagccagtttccaagc
caacagattgccaatgtggtagatgcacacgcctctaccctgacgaagcgcgaagagaga
gatgcattcttcctcaacactcagggcattgtacaactcgtacagaggtatcgtaatggc
gttcgcggtcaccttaaagccgtcgtgcttgcgctactaaggaaatacctccaatccgag
atcctctttaatgaagggaactttgagaagtgtgtgatattgttacgagctcagagcaag
agcaaggacctgtcgtcagtggtctcgactgtcttctctcatgtgaacgtctctaagaag
aacaagctcgccattacgctcattgatcgcttgtgtggttacgaacctggtctgtctgat
gagcttcacagtattttgcaagagttgacgcatcttaacagacaagagcacgctaaggtt
gcactccgagcgagacaggctctattggcgtcacagcagccatcctacgagcgaagacac
aatcaaatcgagtccctcttcctctctgccgttgacataatgggaagccagttctcgcct
gagtcacttcagaaactgatttactccgagacggcaatctttgacgtgttaccaagcttt
ttctatcacaaaaatgaagcagtcagaaaggcagcacttgaggtctatgtccggcggagt
taccaggcgtacgaacttacgacactctaccacgaaatgctgaatgagaatgtctttatt
gtcgagttccagtttagcttgccatcctcacatccaaac

DBGET integrated database retrieval system