KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g20079Help
Entry
NEMVE_v1g20079    CDS       T01037                                 

Definition
hypothetical protein
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:nve01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:nve00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:nve00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:nve00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1093 aa AA seqDB search
VVTPAEFVRKFGGTRVIEKVLIANNGIAAVKCMRSIRRWAYELIGNEKAIKFITMVTPED
LRANAEYIKMADHYSLVPGGSNNNNYANVDLILDVAKRIPVQAVWAGWGHASENPKLPDL
LSKNNITFIGPPAEAMWSLGDKIASTIIAQTVGIPTLPWSGSGLVIENHTEVLEQGGVLT
VPDELYDQASMNEVTDGLKIARSIGYPVMIKASEGGGGKGIRKANNDDEFTNFFRQVQIE
VPSSPIFIMKVAEHSRHLEVQLLVDEYGNAVSLFGRDCSVQRRHQKIIEEAPAAVAKPET
LRKMEEDAINLAKVVGYVSAGTVEYLYNPDDDKYFFLELNPRLQVEHPCTEFIADVNLPA
AQLQVAMGVPLHRIKDIRVLYGKSAYGSDNIVFEPPPPYKKPKGHVIATRITAENPDEGF
KPSSGTVQELNFRSMKDVWGYFSVAASGGLHEYADSQFGHLFAWGEDREDARRNIVLALK
EISIRGDFRTTVEYLIKLLEKDSFKSNRFSTNWLDSLIAEREQTEKPEPILGVIAGAIHV
ADATITKRFANYRDALERGQILPEDCLGNSVDVELIYEGYKYCLTATRLGPNSFFLLMNG
SFVEIETHRLSDGGLLLSFEGHSHTSYMKEQIDSYRMTIGGMTWVFQKQNDPTVLRAPSA
GKLIGYLVEDGGHVFQGETYAEIEVMKMVMPLTVTESGCLHYVKGGGAVLDPGTKVATLE
LDDPSRVTQAQLYTGTFPVSETNSIQKGMKLHQVYQIAKENLQNVMDGYCVDEPYLTPRL
EENVDVLLKSLRNPALPLLELKEMISSIAGRIPLSVEDAIKRHLANYASNLTSLLSQFPS
QQIANVVDAHASTLTKREERDAFFLNTQGIVQLVQRYRNGVRGHLKAVVLALLRKYLQSE
ILFNEGNFEKCVILLRAQSKSKDLSSVVSTVFSHVNVSKKNKLAITLIDRLCGYEPGLSD
ELHSILQELTHLNRQEHAKVALRARQALLASQQPSYERRHNQIESLFLSAVDIMGSQFSP
ESLQKLIYSETAIFDVLPSFFYHKNEAVRKAALEVYVRRSYQAYELTTLYHEMLNENVFI
VEFQFSLPSSHPN
NT seq 3279 nt NT seq  +upstreamnt  +downstreamnt
gtggtcactccagcagaatttgtgaggaagtttggaggaaccagagttattgaaaaggtg
ctgattgcaaacaatggaattgcagcagttaaatgcatgcgttctatccgacgatgggcc
tatgagctcattggtaacgagaaagccatcaagtttatcaccatggtaaccccagaagat
ttacgggccaatgcagaatacatcaaaatggctgatcattactcgctagtacctggcggc
tcaaacaacaataactatgccaatgttgatctgattttggatgttgccaaacgaattcca
gtgcaggctgtgtgggcagggtggggtcatgcttcagaaaatccaaagcttccagacctc
ctctccaaaaataacatcacattcattggtcctcctgcagaagctatgtggtcccttggg
gacaagattgcctctacaatcatcgcccaaactgttggcatacctacacttccctggagt
ggcagcggtctggtgatagaaaaccatacggaagtacttgagcagggaggggtgcttact
gtccctgatgaattgtatgaccaggcatccatgaatgaggtcactgatggactaaagatc
gccagatctattggttatccagtaatgataaaagcatcagaaggtggcggtgggaaagga
ataagaaaagcgaacaatgatgacgagttcacaaacttcttcagacaggtgcagattgaa
gtcccaagctcacctatctttatcatgaaagtcgccgaacattctcgtcaccttgaggtg
caactccttgttgatgagtatggaaatgcggtgtctctttttgggagagactgctccgtt
cagagaaggcatcagaagatcattgaggaagctccagcagctgttgccaaacctgagacc
cttcgcaagatggaggaggatgctattaatcttgcgaaggtagtaggttacgtgagtgct
ggtacagtagagtacctctataatcctgatgatgacaagtacttcttcctggaactcaac
cccagactccaggtggagcacccatgtacagagtttattgccgatgttaaccttccagct
gctcaacttcaggttgctatgggagttcctcttcatcgaatcaaggatatccgagtgctg
tatggcaagtcagcatatggaagtgataacatcgtgtttgagccgcctccaccatacaag
aagcctaaaggtcatgtgattgctaccagaatcacagcagaaaaccctgatgaggggttt
aaaccgagcagtggcacggtgcaagagctgaatttcagaagcatgaaagacgtgtggggg
tactttagcgtggcggcatctggaggcttgcatgagtatgccgactcacaatttggtcac
ctttttgcatggggagaggatagagaggatgctagaagaaatatcgttttagcccttaaa
gaaatctccatccgtggcgacttccgcaccaccgtggaatacttgatcaaacttttagag
aaagattcattcaagagcaacaggttcagcacaaactggctggactcattaatagcagag
cgtgaacagactgagaagccagagcctatccttggagtcatcgccggcgcgatccatgta
gcagatgctaccataacaaagagattcgccaactacagggatgcgcttgagagaggtcag
attctcccggaagattgccttggtaactcagtagatgttgaactcatctacgaaggctac
aagtattgtctgacagccacccgccttggacccaactcattcttcttgctcatgaacggc
tcctttgttgaaatagagactcacagattgagcgatggtgggttgcttctttcttttgaa
ggccacagccacacgtcatacatgaaagagcagattgacagctatcgcatgactattgga
ggaatgacatgggtcttccagaagcaaaacgaccccacggtgctcagagctccttctgct
ggaaagctgattggttaccttgttgaggatggaggtcacgtgttccagggagaaacatat
gcagaaatagaggtgatgaaaatggtcatgcctctcactgtcaccgaaagtggatgtctg
cactatgtcaaaggaggtggggccgttttggatcctgggacaaaggtggctactcttgag
cttgatgatccgagtcgtgttactcaggctcaactttataccggtactttcccagtctct
gaaacgaactccatacagaaaggaatgaagctacatcaagtttatcaaatcgccaaagaa
aacctgcagaatgtgatggacgggtactgtgtggacgagccctatcttacgccaaggctt
gaagagaatgtagatgtgttgctcaagtcattacgcaatccagcccttccgcttcttgag
ctcaaggagatgatatcatctatagccggtcgtatcccactcagtgtggaggatgctatc
aaacgccatttggccaactacgccagcaacctcacttccttactcagccagtttccaagc
caacagattgccaatgtggtagatgcacacgcctctaccctgacgaagcgcgaagagaga
gatgcattcttcctcaacactcagggcattgtacaactcgtacagaggtatcgtaatggc
gttcgcggtcaccttaaagccgtcgtgcttgcgctactaaggaaatacctccaatccgag
atcctctttaatgaagggaactttgagaagtgtgtgatattgttacgagctcagagcaag
agcaaggacctgtcgtcagtggtctcgactgtcttctctcatgtgaacgtctctaagaag
aacaagctcgccattacgctcattgatcgcttgtgtggttacgaacctggtctgtctgat
gagcttcacagtattttgcaagagttgacgcatcttaacagacaagagcacgctaaggtt
gcactccgagcgagacaggctctattggcgtcacagcagccatcctacgagcgaagacac
aatcaaatcgagtccctcttcctctctgccgttgacataatgggaagccagttctcgcct
gagtcacttcagaaactgatttactccgagacggcaatctttgacgtgttaccaagcttt
ttctatcacaaaaatgaagcagtcagaaaggcagcacttgaggtctatgtccggcggagt
taccaggcgtacgaacttacgacactctaccacgaaatgctgaatgagaatgtctttatt
gtcgagttccagtttagcttgccatcctcacatccaaac

DBGET integrated database retrieval system