KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g205628Help
Entry
NEMVE_v1g205628   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NEMVE_v1g205628
Enzymes [BR:nve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     NEMVE_v1g205628
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 191 aa AA seqDB search
MKKKPIVIHGPSGSGKSTLVKRLMKEYPDTFGFSVSHTTRQPRPGEINGKDYNFTERGIM
EKAIENGEFLEFAEYNQNLYGTSKKAVQDVIHVGKVCILDIDVQGVKNVKKAEMKCLYIF
AKPPSLEELENRLRGRGTETDDTLRQRLEIAKSELAYGEEPGNADYTIINDDLDKAYTEF
KDIISKEIVPL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaaacccattgttatacatggcccaagcggaagtggaaaaagcacccttgtc
aaacgcctgatgaaggaataccctgacacatttggtttcagtgtctctcacacaacaaga
caacctagacctggtgaaataaatggaaaagactataattttaccgaaagaggaataatg
gagaaagcaatagagaatggagaatttttagaatttgctgaatataatcaaaatctttat
ggcacaagtaaaaaggcagtccaggatgtaatacatgttggtaaagtctgcatcctcgac
attgatgtacagggtgtaaaaaatgtgaagaaagctgaaatgaaatgtctgtatatattt
gcaaagccaccaagcttagaagagctggaaaataggctacgtggccgtggcactgaaact
gatgacactttgcggcagagattggaaatagccaagagcgaattagcatatggggaagaa
ccaggcaatgcagactatacaatcataaatgatgaccttgacaaagcatataccgagttt
aaagacatcataagcaaggagatcgtgccattgtga

DBGET integrated database retrieval system