KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g207033Help
Entry
NEMVE_v1g207033   CDS       T01037                                 

Definition
hypothetical protein
Organism
nve  Nematostella vectensis (sea anemone)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 223 aa AA seqDB search
MEKVYDTNSHQQAISGILLGTGASVSIPDETLEDLERSSVFNSKEIQKLLKRFCRYDPDV
THGITLKDFLTIPEVSTQPIMVKIARFFLDSETRLLTFRDFIGLLSVLSTRETLDNKKEW
VHCKLCTYLLKLISLILTSSTLPVAFKVLDMDSNGILTPDEMFSFYRTLLGPSPSDDEVM
RVAMAAMSHGADHREQLSYDDFCQLISDEELMALFTMELQLPK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaggtgtatgatactaacagtcatcaacaagcaatatcagggattcttctgggt
accggtgcatctgtatcaatacctgacgaaaccttagaagatctggaacgctccagcgta
ttcaactcaaaggaaattcagaaactcttgaagcgcttttgtcgttatgatcctgacgtt
acacatggaataaccctaaaggatttcttaacaatacccgaagtctccacgcagccaatc
atggtgaagatagccaggttctttctggactctgagaccagattattgaccttcagggac
tttattgggcttctctcagtcctaagcacacgtgagaccttggacaataagaaagaatgg
gtgcactgcaagctctgcacttatttgctaaagctcatttctttaatattgacgagttcc
accctgccagttgcattcaaggttctagacatggatagcaatggaatcctaacccctgat
gagatgttcagcttttatcgcaccctgcttggcccctccccatcagatgacgaagtgatg
cgtgttgccatggctgccatgtcccatggggctgaccacagggaacaactctcatatgac
gatttctgccagctgatctccgatgaggagttgatggcactcttcacaatggagctgcaa
cttccaaaatag

DBGET integrated database retrieval system