KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g207217Help
Entry
NEMVE_v1g207217   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:nve00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 496 aa AA seqDB search
MVVANKLSSRFTVLGGGISGLSAAYYLAKHHSKPSDITVLEASGRFGGWMHSKRSPEGAV
FEQGPRSLRPAGPPGWTTLDLVSELGLESNIIPVNTSHPGATNRFIYSRGKVHKLPNSII
SILKKQSLFSQSLLPTILKEPFKEKRISENDESVYSFFSRRLNREVAEYIGDPVCRGIFA
GDARALSLRAVFPAVYEMEKNYGSVVKGALLGKSVKPGPDASPLVQRSINEKWSIWSLDG
GLQTFADKLHNSLNQMGVKFIVGKPCFAIDFTDDYKAILQIAEEKLETDHLISSLSADRL
ASILPSSHSNLVDALSEIKPVSVGLVNLEYNGNIIKDEGFGVLLPSSEATKVLGIIYDSC
LFPQHDRKDGGHTRLTVMMGGHWFEEQFGHPDIVDTSVLTDTAVDAVAKIMGVSKDPIKT
LTSVQTNCISQYHIGHTSRVNRIFNYVRDNGLPLSLVGSSYKGVGVNDCVYNAKVMVEEL
VAKNGNKDRGIVSEVE
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggtggtcgccaataaactctcctcccggtttaccgtgctcggtggtgggatatccggg
ctgtccgccgcctactatctcgctaaacaccatagcaagcctagcgatatcacagttctc
gaggcaagtggaagatttgggggctggatgcatagcaaacgaagtcctgagggagctgtt
ttcgaacaaggtccacgtagcttgcgccccgccgggcctccgggctggacgactctcgac
ttggtttcagaactgggtcttgaaagtaatatcatcccagtcaatacttcccacccagga
gcgaccaacaggtttatttactctcgtggaaaagttcacaagcttccaaacagtataata
tctatcttgaaaaaacagtcgcttttctcgcagtctttacttcccacaatcctgaaggag
ccatttaaggagaagagaatcagtgagaatgatgaatcagtttatagctttttcagcagg
cgattgaatagggaggtggctgaatacattggggaccctgtctgcagaggcatttttgca
ggagatgctcgagcactgagccttcgggcagtgttccctgctgtctatgaaatggagaag
aactatggatctgtggtcaaaggggcacttttaggaaaatcagtaaaacctggtcctgat
gcatctcctctggtccagagatcaatcaatgagaagtggagcatctggtctctcgatggt
ggactccaaacatttgctgataaacttcacaattccctcaaccagatgggtgtcaagttt
attgttggcaagccttgctttgcaatagacttcacagatgattacaaagccattcttcaa
atagctgaagagaaattagaaactgatcacttgatttcatcattatctgctgacagacta
gctagtatattaccttcaagtcactcaaacttagtagatgccctgagtgaaatcaaacct
gtctctgttggacttgtgaacttagagtataatggcaatatcatcaaggatgaagggttt
ggagtcttgctcccgtcttctgaagcaaccaaagtccttggcatcatttatgactcatgt
cttttccctcagcatgacagaaaggatggtggacacactcggctgacggttatgatggga
ggtcactggttcgaggaacagtttggacacccagatatagtagacacaagtgtcttaact
gacactgctgtagatgcggtagccaagattatgggtgtctctaaagatcccatcaaaact
ctcacatcggtccaaacaaactgcatatcccagtaccacataggccacaccagtagagtc
aatagaatatttaactatgttagagataatgggcttcctttgtctctagtaggttcgtca
tacaaaggggtgggggtaaatgattgtgtttataatgccaaggtgatggtagaggagtta
gtagctaagaatggtaataaagatagggggatagtgagtgaggttgaatga

DBGET integrated database retrieval system