KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g207217Help
Entry
NEMVE_v1g207217   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00860  Porphyrin and chlorophyll metabolism
nve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NEMVE_v1g207217
Enzymes [BR:nve01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     NEMVE_v1g207217
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     NEMVE_v1g207217
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO MCRA Thi4 Pyr_redox_2 NAD_binding_9 Pyr_redox Trp_halogenase FAD_binding_2
Motif
Other DBs
NCBI-GeneID: 5512650
NCBI-ProteinID: XP_001633012
JGI: 207217
UniProt: A7S5R2
AA seq 496 aa AA seqDB search
MVVANKLSSRFTVLGGGISGLSAAYYLAKHHSKPSDITVLEASGRFGGWMHSKRSPEGAV
FEQGPRSLRPAGPPGWTTLDLVSELGLESNIIPVNTSHPGATNRFIYSRGKVHKLPNSII
SILKKQSLFSQSLLPTILKEPFKEKRISENDESVYSFFSRRLNREVAEYIGDPVCRGIFA
GDARALSLRAVFPAVYEMEKNYGSVVKGALLGKSVKPGPDASPLVQRSINEKWSIWSLDG
GLQTFADKLHNSLNQMGVKFIVGKPCFAIDFTDDYKAILQIAEEKLETDHLISSLSADRL
ASILPSSHSNLVDALSEIKPVSVGLVNLEYNGNIIKDEGFGVLLPSSEATKVLGIIYDSC
LFPQHDRKDGGHTRLTVMMGGHWFEEQFGHPDIVDTSVLTDTAVDAVAKIMGVSKDPIKT
LTSVQTNCISQYHIGHTSRVNRIFNYVRDNGLPLSLVGSSYKGVGVNDCVYNAKVMVEEL
VAKNGNKDRGIVSEVE
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggtggtcgccaataaactctcctcccggtttaccgtgctcggtggtgggatatccggg
ctgtccgccgcctactatctcgctaaacaccatagcaagcctagcgatatcacagttctc
gaggcaagtggaagatttgggggctggatgcatagcaaacgaagtcctgagggagctgtt
ttcgaacaaggtccacgtagcttgcgccccgccgggcctccgggctggacgactctcgac
ttggtttcagaactgggtcttgaaagtaatatcatcccagtcaatacttcccacccagga
gcgaccaacaggtttatttactctcgtggaaaagttcacaagcttccaaacagtataata
tctatcttgaaaaaacagtcgcttttctcgcagtctttacttcccacaatcctgaaggag
ccatttaaggagaagagaatcagtgagaatgatgaatcagtttatagctttttcagcagg
cgattgaatagggaggtggctgaatacattggggaccctgtctgcagaggcatttttgca
ggagatgctcgagcactgagccttcgggcagtgttccctgctgtctatgaaatggagaag
aactatggatctgtggtcaaaggggcacttttaggaaaatcagtaaaacctggtcctgat
gcatctcctctggtccagagatcaatcaatgagaagtggagcatctggtctctcgatggt
ggactccaaacatttgctgataaacttcacaattccctcaaccagatgggtgtcaagttt
attgttggcaagccttgctttgcaatagacttcacagatgattacaaagccattcttcaa
atagctgaagagaaattagaaactgatcacttgatttcatcattatctgctgacagacta
gctagtatattaccttcaagtcactcaaacttagtagatgccctgagtgaaatcaaacct
gtctctgttggacttgtgaacttagagtataatggcaatatcatcaaggatgaagggttt
ggagtcttgctcccgtcttctgaagcaaccaaagtccttggcatcatttatgactcatgt
cttttccctcagcatgacagaaaggatggtggacacactcggctgacggttatgatggga
ggtcactggttcgaggaacagtttggacacccagatatagtagacacaagtgtcttaact
gacactgctgtagatgcggtagccaagattatgggtgtctctaaagatcccatcaaaact
ctcacatcggtccaaacaaactgcatatcccagtaccacataggccacaccagtagagtc
aatagaatatttaactatgttagagataatgggcttcctttgtctctagtaggttcgtca
tacaaaggggtgggggtaaatgattgtgtttataatgccaaggtgatggtagaggagtta
gtagctaagaatggtaataaagatagggggatagtgagtgaggttgaatga

DBGET integrated database retrieval system