KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g207221Help
Entry
NEMVE_v1g207221   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
nve  Nematostella vectensis (sea anemone)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 128 aa AA seqDB search
MSWQQFVDESLLGTSQVAKASIHGLNGERYASSSGFVVLPSEAQVLIAAITKDPSPTYYK
GVCLNRTKYFVIRVDPGHSLYCRKGNEGAVAVLTSQCLLIGAYSEGMTPGCCSAVTEKLA
DYFRVNGF
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcagcaatttgtagatgagagcttgctcggcacaagtcaagtggccaaagct
tcaattcatggtctaaatggcgagcggtacgcttctagctcaggatttgtggttcttcca
agcgaagcccaagttttgattgctgcaatcaccaaagacccaagcccgacctactacaaa
ggagtgtgccttaatcgaaccaagtactttgtgattagagtcgacccaggccactccctc
tactgccgcaaggggaatgagggcgcggttgcagtccttacaagccagtgtctgttgata
ggggcctacagtgaagggatgactcctggttgttgttctgctgtgaccgaaaaacttgca
gattactttagagttaatgggttttga

DBGET integrated database retrieval system