KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g210271Help
Entry
NEMVE_v1g210271   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NEMVE_v1g210271
   00670 One carbon pool by folate
    NEMVE_v1g210271
Enzymes [BR:nve01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     NEMVE_v1g210271
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 187 aa AA seqDB search
MAAVGVRFSCIVAMDLKRGIGKNNDLPWKIKGDMKFFTEKTSEVKTEGKQNAVIMGRKVW
ESIPEKFRPLKGRLNIVLSRTLSEPPQGAQLCRSFEQALTILSTDPYTKKIENVFVCGGS
ALYKDAMAHSACTRIYITYIDQEFDCDVFFPEFDQNTYHLVEDPDVPSVQHEEKGIKYKF
CVYDRCQ
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgtgggagttcgattctcttgtatcgttgcaatggacttgaagcgagggatt
ggcaaaaataatgaccttccatggaaaataaaaggtgatatgaagttctttaccgaaaaa
acatctgaggtaaaaacagaaggaaaacagaatgcagtaataatgggccgaaaggtttgg
gaatctattcctgaaaaattccgccctctcaaagggagactaaacattgttcttagcagg
acattaagtgagccaccacagggagcccagctctgtagaagcttcgaacaagctctaaca
attctttcaactgatccttacacaaaaaagatagaaaatgtgtttgtttgtggtggttca
gctttgtataaggatgcaatggcccattcagcttgcaccagaatctacattacctacatc
gatcaagagtttgattgcgatgtattttttcctgaatttgatcaaaatacctaccattta
gttgaagaccctgacgtaccaagtgtccagcatgaggagaaaggcatcaaatacaagttc
tgtgtgtatgataggtgtcaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system