KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g210710Help
Entry
NEMVE_v1g210710   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    NEMVE_v1g210710
Enzymes [BR:nve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     NEMVE_v1g210710
Transfer RNA biogenesis [BR:nve03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    NEMVE_v1g210710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 319 aa AA seqDB search
MTSSVPFIVRLVSSSVSIANRAGSVIRDILKKGELGIIDKSAAGSGKFDPQTEADRAAQR
CIIGSLLVQFPSLRIVGEEEGIDANDLGDDLLVTSQDSSILDVKCPENLNNIKAEDVVVW
VDPVDGTKEFTEGLLHHATVLIGVSYEGRPVAGVIHQPFFGHNSSSDLSKLGRTLWGING
LGAFGFKTKPIPDGRRIITTTRSHLTQDVTDAIAAMKPESVLKVGGSGYKVLLLLDGDAD
GYIFASPGTKMWDTCACQAILEAVGGKLTDICGNEVVYDFDAESYLNRLGVVAALREHDW
YIEMIPDTVRDGLRKKQKL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgagcgtcccattcatcgtacggcttgtatctagctctgtatctatcgcgaat
cgagcaggaagtgttatcagggacattctaaaaaaaggagaactcggtattatcgacaag
tctgctgcaggttccgggaagttcgacccacagactgaggctgaccgtgccgcccagcga
tgcattattggctccttactggtgcagttccctagcctgcgaatagtaggagaagaagag
ggcattgacgccaatgacctgggggatgacttactagtcactagccaagactcttctatc
ttagatgtcaaatgccctgaaaacctcaacaacatcaaagctgaagatgttgttgtatgg
gtggacccagtagatggaacaaaggaattcactgaaggactcctgcaccacgccaccgtc
ttgataggcgtgtcctacgaggggcgtcctgttgctggagtcatccatcagccattcttc
ggccataattcttcttcagatctctccaaacttggcagaactctctggggtataaacggt
ctgggcgcatttggattcaagacaaagcctatacctgatggccgacgtattatcacaact
acccgctcccatttgacacaggatgtcaccgatgctatagcggcaatgaagcccgaaagt
gtccttaaagtaggaggttccggttataaggtcctcctccttcttgatggtgatgctgat
ggctatatatttgccagcccaggaacaaagatgtgggacacctgtgcatgtcaagcaata
ctagaggctgtgggaggcaagctgactgatatctgtggcaatgaagtggtgtatgatttt
gatgccgaatcctatcttaataggttaggtgtggttgctgcactaagggaacatgattgg
tatattgaaatgataccagacacagtaagggacggactcaggaaaaaacagaaactttga

DBGET integrated database retrieval system