KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g211198Help
Entry
NEMVE_v1g211198   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NEMVE_v1g211198
Enzymes [BR:nve01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     NEMVE_v1g211198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 305 aa AA seqDB search
MPRAGGIATMMRLPHQKSAVGLDVCFVGVPFDTGTSNKTGTRYGPRQIRWESSMLRPYNP
ATGAAPFESLMVADVGDIPINNFNISKTVDIIRTKIEEFICDGCFPLTMGGDHTITYPIL
QAIKNKHGPVGLVHVDAHMDLHNKMCDEAVYHGSPFFRAFEEGLLDPKRVVQIGLRGSLY
DNNAYNIPKDLGFRVVPAVDCWYKSMAPLMAEVQEQMGDGPVYISFDIDGLDPSIAPGTG
TPEIGGLTAIQGLEIVRGCQGLNVVGGDLVEVSPPYDTTGITALTGANLLFEMLCVLPGV
KYYKH
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgccaagagctggcggcatagctaccatgatgaggctccctcatcagaaatcagccgtc
ggtctggatgtttgctttgttggtgttccgtttgatactgggacatctaataaaactgga
acaaggtacgggcctagacaaataaggtgggagtctagtatgctgcggccatataaccca
gctacaggtgctgcaccctttgaatcactcatggttgcagatgttggagacatccctatc
aacaacttcaacattagcaagactgtagacattatacgcacaaagattgaggaatttatt
tgtgatggctgcttccccctgaccatgggtggagatcataccattacctaccctattttg
caagcgataaagaataaacatggacctgtaggcctggtccatgtggatgcacacatggat
ttgcacaacaagatgtgtgatgaggctgtgtatcatggtagtccattttttagagctttt
gaggagggtttgcttgatcctaagagagttgtacaaattggtctcagaggaagcttatat
gacaataatgcctataacataccaaaggatttaggtttccgtgtcgtccctgcggtggat
tgctggtacaagtctatggcgccactcatggctgaagttcaggagcagatgggtgatggg
ccggtctacatctcctttgatatagatgggcttgacccctccattgcaccaggaactgga
accccagaaattggtggcctcacggcgatacaaggcctggagatcgtaaggggatgtcag
ggactgaatgttgtgggtggcgacttagtcgaggtttccccgccatacgacactacaggc
atcacagcgcttacaggcgctaacctgctgtttgaaatgctctgtgttcttcccggtgtt
aaatactacaagcattag

DBGET integrated database retrieval system