KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g213886Help
Entry
NEMVE_v1g213886   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:nve00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 515 aa AA seqDB search
MSEFKDFGPLVGAIDQGTSSSRFLLFASNTAELLAFHQVEFQSIYPKEGWVEQDPKTLLS
SVYQCMEQTLQSCKELNINPTDIKAVGITNQRETTVVWDKVTGEPLHNAIVWLDTRTKST
VDKIVSKNSKSTLENVRSICGLPVNTYFSAVKLRWLIDNSEPVRKAVDDGRCMFGTVDSW
LLWNMTGGPNGGQHITDITNASRTMLLNLKTQEWDPYLCKFFDLPMSVLPTIKSSSEIYG
KLCDGPLSGTPISGVLGDQQAALVGQMCFRRGEAKNTYGTGCFLLYNTGIEPVLSHNGLL
TTVAYKLGPDQPTFYALEGSVAIAGAAVQWLRDNMKLIENSSEIEALASSVPTSAGVYFV
PAFSGLYAPYWQMDARGVIVGLTQFTNRAHIARATLEAVCFQTRELLDAMNEDCGIPLAS
LLVDGGMTVNRLLMQLQADILGISVERPTMPETTALGAAMAAGAAKGIEVWDLNPEDKSQ
INTEVFDPAMDTSERDRHFSKWKKXRTADHEMGSR
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaattcaaagactttggaccgcttgttggagcaatcgatcaagggacatcgagc
agccgatttctgctctttgccagtaacacagctgagctccttgccttccatcaagtagag
ttccagagcatctacccaaaagaaggatgggttgagcaggacccaaaaacacttctgtca
tcagtttaccagtgtatggagcaaaccctacagagctgcaaagagctaaatatcaaccct
actgatatcaaagctgtaggtatcactaatcaaagagaaacaactgttgtctgggataaa
gtaactggagaaccacttcacaatgcaatagtttggctggacaccaggacaaagtcaaca
gtggacaaaattgtctcaaagaactcaaagagcacccttgaaaatgtcagatcaatttgt
ggactgcccgtcaacacctacttcagtgctgtcaagttgcggtggttgattgataatagt
gaacctgtccgtaaggctgtagatgatggcaggtgtatgtttggcacagttgactcatgg
cttctttggaacatgacaggagggcctaatggaggccaacatatcacagacatcactaac
gcctctaggacaatgctcttgaacctgaagactcaagaatgggacccctacctttgcaaa
tttttcgacttgcccatgagtgtcctaccaacaataaagagttcatcagaaatatatggc
aaattgtgtgatgggccattaagtggtactcccatatctggggttcttggtgaccagcaa
gcagcgcttgtgggacaaatgtgtttccgacgtggagaggcaaagaacacgtatggcaca
ggttgtttcctactgtacaacacaggcatcgagcctgtgttgtcgcacaatggactgctg
acgacagtcgcttataaactcggcccagaccagccgaccttctacgcacttgagggctct
gtggccatcgctggtgcagctgttcagtggctaagggataacatgaaacttattgagaac
tcatcagagatagaagcccttgcgtcgagcgtgccaacctcggcaggagtatactttgtg
cccgccttctctggtctgtatgcgccctattggcaaatggacgctcgcggggtaatcgta
ggtctgacgcagttcacaaacagagcgcacatagcacgtgctacgctagaggctgtttgc
ttccagacgagagagctgttagacgcgatgaatgaagactgtggtataccgctggccagt
ttgcttgtggacgggggtatgactgttaatagactcttgatgcagctacaagcagacatc
ctggggatttccgtagagcgaccaacaatgcctgagacaacagctctcggagccgccatg
gccgcgggagcagctaaagggattgaggtctgggacctaaaccccgaagacaagtcacaa
attaacacagaagtatttgacccagccatggatacctctgagcgtgatcgccatttttcc
aagtggaaaaaagnccgtacagcggaccatgaaatgggaagtagatga

DBGET integrated database retrieval system