KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g215593Help
Entry
NEMVE_v1g215593   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00933  
creatine kinase [EC:2.7.3.2]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NEMVE_v1g215593
Enzymes [BR:nve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     NEMVE_v1g215593
Exosome [BR:nve04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   NEMVE_v1g215593
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 683 aa AA seqDB search
MKKYLTEEMFNELKDKKTELGVTLSDCINSGVENLDSGTGIYAGDEESYKLFAPLFDKII
EDYHAPYKLEQKHTSDMNPEKVEAPDLDPEGSFIRSTRIRVARNLKGYALTPALSKKARL
EIEEKVKNVFESLTGDLAGKYHPLDGMTEETRQQLVNDHFLFKKGDRFLEAAGVNKLWPE
GRGIFHNNDKTFLVWVNEEDQLRIISMEMGSDIGSVFKRLCTAVNEIDKQLGFQHTEEHG
YLSSCPTNLGTGMRASVHVKIPHASAHPDFQKICDEFHIQARGIHGEHSVSTGADAGVFD
ISNKRRLGLSEVQCVQDMYNGVKKLLEIERAAIEEAHLKFPEDLKKPEVKSLLKKYLTED
VFNSLKEKKTSRGAGLYDCINSGVVNLDSGTGVYAADEECYEVFGELFDKIIEDYHAPYK
LEENHKSDMDPEKVDAPNLDAEGAFIRSTRIRVARNLKGYALTPGLTRKERVDVESKVVG
VLNSLTGDLAGKYYPLSGMDEATRQQLVDDHFLFKKGDRFLEAAGVNKMWPEGRGIFHNN
DKTFLVWVNEEDQLRIISMEMGSDIGSVFSRLCRAVNEIDKQLGFAHKETHGYLSGCPTN
LGTGMRASVHVKIPKASEHPDFQKICDEFHIQARGIHGEHSVSTGEDAGVFDISNKRRLG
LSEVQCVQDMYNGVKKLLEIEKA
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagtacctgacggaagagatgtttaacgagctcaaggacaagaaaactgagcta
ggtgtcactttgagtgactgcataaactcaggagtcgagaacctggactctggcactggc
atttatgcaggagatgaagagagctataagctgtttgcacctctttttgacaagatcatc
gaagactatcacgctccttacaaactggagcagaagcacactagtgatatgaaccccgag
aaggtcgaggccccagacttggaccctgagggctcttttatcaggtcaactcgcatccgt
gtggcccgtaacctgaagggctatgccctgacccccgccctttctaagaaagcacgcctg
gagatagaggaaaaggttaaaaatgtatttgaatccctaacgggtgacttggctggcaaa
taccacccgctggacggcatgacggaagaaacgagacagcaacttgtcaacgatcacttt
ttatttaaaaaaggtgatcgctttcttgaggccgccggagtgaacaagctctggccagaa
ggacgtggtatcttccacaacaacgacaagaccttcctggtctgggtgaacgaggaggat
cagctacgtatcatcagcatggagatgggcagtgacatcggctctgtgttcaagaggctc
tgcacggcagtgaacgagattgataaacaactcggattccaacacacagaggagcatggt
tatctctcatcttgccctactaacctcggcacgggcatgcgcgctagtgttcacgtcaag
atcccccatgctagtgctcatcccgacttccaaaagatctgcgatgagttccacatccag
gcacgtggcatccatggagaacactcggtatctactggggcagatgcaggtgtgtttgac
attagtaacaagagaaggctgggcttgtccgaggtgcaatgtgtgcaggacatgtacaat
ggcgtcaagaaacttttggagattgagagagctgcgatcgaggaggcacatttaaagttt
cccgaagaccttaaaaagccggaggtgaagtctctcttgaaaaagtacttgacagaagac
gtgttcaattccttgaaggagaagaagacatcacgtggggcgggtctttacgattgcatc
aactctggcgtcgtcaacctggactctggcacgggcgtgtatgctgctgacgaggaatgc
tatgaagtattcggggaactcttcgacaagatcatcgaggattaccatgctccctacaag
ctcgaggaaaaccacaaatcagacatggacccagagaaggttgacgcccctaatctcgat
gctgaaggagcattcattcgctcgacacgcatccgagtggccaggaatttaaaggggtat
gcactgacgcctggattaaccaggaaagagcgtgttgatgtagagagtaaggtggttgga
gtactgaactctctgaccggtgacctggcaggaaagtactacccactcagtggtatggac
gaggcaaccaggcagcagctggtggatgaccatttcctcttcaagaagggtgatcgcttc
ctggaggctgccggagtcaacaagatgtggcctgaaggtagaggaatcttccacaacaac
gacaagactttcctggtctgggtgaacgaggaggatcagctacgtatcatcagcatggag
atgggcagtgacatcggctctgtcttcagtaggctctgccgcgctgttaacgagatcgac
aaacagctcggatttgcacacaaggaaacacacggttatctctcgggctgccccaccaac
ctcggtacaggcatgcgcgctagtgttcacgtcaagatccctaaggcaagcgagcatccc
gacttccagaagatatgcgatgaattccacatccaggcacgtggtattcacggagaacat
tcggtatccactggagaggacgcaggtgtgtttgacatcagtaacaagagaaggctgggc
ttgtccgaggtgcagtgcgtgcaggacatgtacaatggcgtcaagaaactcctggagatc
gagaaagcctaa

DBGET integrated database retrieval system