KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g216070Help
Entry
NEMVE_v1g216070   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Enzymes [BR:nve01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     NEMVE_v1g216070
Peptidases [BR:nve01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NEMVE_v1g216070
Ubiquitin system [BR:nve04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    NEMVE_v1g216070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 341 aa AA seqDB search
MGKKSKRHGHGGHNKGKNNRQQDENSSNGGGSNSEGSKKCSHITKAIKLGVLQNHIPHMK
IGQCSVCNEVPNKNTSICICLRCSKQGCDRYSNGKHGLSHYEDTPSHCITVNLSSLMVWC
YSCDIEIPVAPNTDLQDCINLLLKALQSTGRQLQGNGLLPKVVLRDVTQDSEIMARHYHP
QHKLVKGLVNLGNTCFFNAVMQNLCQTELLYLVMKFASQDDYMHTFTAPNKQLSELSVKV
ATPPGSLTMALKKLLIQMKNSDPGPLNPKHLFSEICKKSPRFRGYQQQDSQELLRCLLDS
IKTEQLRRLKIGVLDAFGVNAEEGGTLKQLSEEKKDIVRDL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaaaagtaaaagacatgggcatggtggccacaataaagggaaaaacaacaga
caacaggatgaaaattcttcaaacggaggaggaagcaactcggaagggtccaagaaatgt
tctcatatcacgaaagctattaagcttggggtccttcaaaaccacatcccacatatgaag
attggacaatgctctgtttgtaatgaagtaccaaacaagaatacctctatctgtatttgc
ctgcgatgttccaaacaaggctgtgaccggtacagcaacggcaagcatggattgagtcat
tacgaagacacaccctctcattgtataactgtcaacttgagttctctcatggtctggtgt
tactcctgtgacatagagattcctgttgctccaaacactgatttacaagactgcatcaac
ctacttctcaaagcactacagtcgacaggccgacagcttcaggggaacgggctactgcct
aaagttgtgctcagagatgtgacacaggattcagagatcatggccaggcattaccaccct
cagcacaagcttgttaaggggcttgtaaacttgggaaacacctgtttcttcaatgctgtc
atgcagaatctctgtcagactgagctgctgtaccttgtcatgaagtttgccagtcaggac
gattatatgcacaccttcacagctccaaacaagcaactgtctgagctttcagtcaaagtg
gccacacctccaggttcattgacgatggcactaaagaaactactcattcagatgaagaac
tctgacccaggacctctcaaccctaagcacttattctcagagatctgcaagaaatcgcct
cgtttccgtggttaccagcagcaggacagccaggaattacttcggtgcttactggactcg
attaagacggaacaactacggcgcctcaagattggtgtcttggacgccttcggtgtgaac
gccgaggaaggtggtaccttgaaacaactgtctgaggagaagaaagacatagtcagagac
ctataa

DBGET integrated database retrieval system