KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g216070Help
Entry
NEMVE_v1g216070   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
nve  Nematostella vectensis (sea anemone)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 341 aa AA seqDB search
MGKKSKRHGHGGHNKGKNNRQQDENSSNGGGSNSEGSKKCSHITKAIKLGVLQNHIPHMK
IGQCSVCNEVPNKNTSICICLRCSKQGCDRYSNGKHGLSHYEDTPSHCITVNLSSLMVWC
YSCDIEIPVAPNTDLQDCINLLLKALQSTGRQLQGNGLLPKVVLRDVTQDSEIMARHYHP
QHKLVKGLVNLGNTCFFNAVMQNLCQTELLYLVMKFASQDDYMHTFTAPNKQLSELSVKV
ATPPGSLTMALKKLLIQMKNSDPGPLNPKHLFSEICKKSPRFRGYQQQDSQELLRCLLDS
IKTEQLRRLKIGVLDAFGVNAEEGGTLKQLSEEKKDIVRDL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaaaagtaaaagacatgggcatggtggccacaataaagggaaaaacaacaga
caacaggatgaaaattcttcaaacggaggaggaagcaactcggaagggtccaagaaatgt
tctcatatcacgaaagctattaagcttggggtccttcaaaaccacatcccacatatgaag
attggacaatgctctgtttgtaatgaagtaccaaacaagaatacctctatctgtatttgc
ctgcgatgttccaaacaaggctgtgaccggtacagcaacggcaagcatggattgagtcat
tacgaagacacaccctctcattgtataactgtcaacttgagttctctcatggtctggtgt
tactcctgtgacatagagattcctgttgctccaaacactgatttacaagactgcatcaac
ctacttctcaaagcactacagtcgacaggccgacagcttcaggggaacgggctactgcct
aaagttgtgctcagagatgtgacacaggattcagagatcatggccaggcattaccaccct
cagcacaagcttgttaaggggcttgtaaacttgggaaacacctgtttcttcaatgctgtc
atgcagaatctctgtcagactgagctgctgtaccttgtcatgaagtttgccagtcaggac
gattatatgcacaccttcacagctccaaacaagcaactgtctgagctttcagtcaaagtg
gccacacctccaggttcattgacgatggcactaaagaaactactcattcagatgaagaac
tctgacccaggacctctcaaccctaagcacttattctcagagatctgcaagaaatcgcct
cgtttccgtggttaccagcagcaggacagccaggaattacttcggtgcttactggactcg
attaagacggaacaactacggcgcctcaagattggtgtcttggacgccttcggtgtgaac
gccgaggaaggtggtaccttgaaacaactgtctgaggagaagaaagacatagtcagagac
ctataa

DBGET integrated database retrieval system