KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g218982Help
Entry
NEMVE_v1g218982   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:nve04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 487 aa AA seqDB search
MLYSTAFVLLFVGSTLSSDVLDLGDSNFKSGVAGKDIMLVEFFAPWCGHCKRLAPEYETA
AEALKKNDPPVPLAKVDCTEAGKDTCSKYGVSGYPTLKIFRNGEMSKDYDGPRDSSGIIR
YMKKQAGPSSVEIKSVDHLEKKLDDAESNVVVGFLDGDDDLKNAFMRTANEMRDSFSFAH
ASVTDVLEKYNYKNQIVVFRPKHLHTKLEPSFIAYTGSPDDFYIKKFINAKAHGRVGQRT
PDNEEQFPKPLCVVFFDVDWKKNAKGSKYWRNRVLKVTKFFDDKAMNFAIASFSDYERVL
SDIGVTDKANPSAVVYNDAGDKFLMKEKFSVDSFKQFLEDYFAGSLKPHIKSEPLPESND
GPVKVVVGENFKEIVNDPTKDVLIEFYAPWCGHCKSLEPKYNELGEKLQDVKDIVIAKMD
ATANDAPPNFSVQGFPTIYWAPANNKENPEKYEGGREVSDFVDFIKRKATKPVNLDEKKK
KKSKSEL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgttgtattctacagcttttgtacttttatttgtgggctcaaccctttcttcagatgtc
ttggatctaggggatagtaattttaaatccggggttgccggtaaagatataatgctcgtc
gagttcttcgccccttggtgcgggcattgcaaaagactagcccctgaatatgaaactgct
gccgaggctttgaaaaagaacgatccaccggttcctctagcaaaggttgattgtactgaa
gctgggaaggacacttgtagcaaatatggcgttagtggctaccctacactgaaaatattc
cgtaatggcgagatgtcaaaggattatgacgggccacgtgattcaagtggaattattaga
tatatgaaaaagcaggctggaccaagctctgttgaaattaagtcagttgaccatcttgag
aaaaagctggatgacgctgaatctaatgtagttgttggttttcttgatggcgatgatgat
ctcaagaatgctttcatgaggactgcaaatgagatgagagattcattttcatttgcacat
gcaagtgttactgatgtcttagagaaatacaactacaaaaatcaaatagtcgtgttcaga
cccaagcaccttcacacaaagcttgagccaagttttattgcctacactgggtcaccagat
gacttctatatcaagaaattcatcaacgccaaggcacatggtcgtgttggccagagaaca
ccagacaatgaggagcaatttcctaaacccctttgtgtagttttctttgacgtggattgg
aagaagaatgccaaaggttccaaatactggcgcaacagagtgcttaaggtgaccaagttc
tttgatgacaaggccatgaactttgccattgcctctttctctgactacgagcgagtccta
tctgatatcggcgttactgacaaagccaaccctagtgccgttgtctacaatgatgctggt
gacaagttcttgatgaaagagaaattcagcgttgattcattcaagcagttcctggaagac
tactttgctggcagcctgaagccacatatcaaatctgagccactccctgagagcaatgat
ggccccgtcaaggttgttgttggtgagaacttcaaggagattgtaaacgacccaacaaag
gatgtcctgatagagttttatgccccgtggtgtggacactgcaagagtctggagcccaag
tacaatgaacttggtgagaaactccaggatgtcaaggatattgtcattgctaagatggat
gccaccgctaatgatgcaccaccaaacttcagtgttcagggattccccactatttactgg
gcgccagccaacaacaaagagaaccccgagaaatacgagggtgggcgagaggtatctgac
tttgttgacttcatcaagcgcaaagcaaccaaaccagtcaatttagacgagaagaagaag
aaaaagtcaaagagcgagctttaa

DBGET integrated database retrieval system