KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g224716Help
Entry
NEMVE_v1g224716   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nve01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:nve00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 315 aa AA seqDB search
MRNIKIIEVNSEIGAGTRGASLGIEAMKVAALDFMSSFFVNFPSEKIETENHLLYEPITS
PYAKRIQGVNTMYERISQSVKETLDSGLFPLVLAGDHSTAGGTIAGIKMAYPKDELGVVW
IDAHADLHTPYTTPSGNMHGMPLAASLGEDNTSCKVHNLDKETASLWDKLKNIGGINPKI
KPENIVFIALRDYEEQEKAIIKKHGIKIITVQEVRRKGIENVVKNTLLHLAHCEHIYVSF
DVDSLDSSISRGTGTPVSNGLKLREADDMIAAFVQNHKLCCLEVTEVNPTLDSENLMAEM
AFNILQRSVNLLLVN
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcggaatataaaaataatagaagtcaactcagaaataggtgcaggcactagaggtgct
agtcttggtattgaagccatgaaggtagctgcactcgactttatgagtagcttctttgtc
aactttccatcggagaaaatagaaacagagaaccacttattatacgagcctatcacgtct
ccatacgccaagcgtatacaaggtgtaaacaccatgtacgagcgtatatctcaatcggta
aaagaaactttagactctggtttattccccttagtattagctggcgaccatagcactgcg
ggtggtactattgcaggtataaaaatggcttatcctaaagatgagttaggagtagtatgg
atagatgcccatgccgatttgcatacaccatacactaccccatcgggcaatatgcacggt
atgcctctagctgcctcgctaggagaagacaacaccagctgcaaagtgcacaacctagat
aaagaaaccgcatctttatgggacaagcttaaaaacataggaggcattaaccctaagata
aaaccagagaatatcgttttcattgcgctgagagactatgaggaacaagagaaagctatt
ataaaaaagcatggtataaaaatcattaccgtgcaggaggtaagaagaaagggtatagag
aacgttgtaaaaaacacattgctacacctagctcattgcgagcatatatatgtgtctttc
gatgtagattctcttgacagctctatatctaggggcacaggcacacctgtaagcaatgga
ctaaaactacgtgaagctgatgatatgattgcagcttttgtacaaaaccacaagctctgc
tgcctagaggtaacagaagtaaaccctactctagattctgaaaacctaatggctgagatg
gccttcaacatattgcaacggagtgtgaacctcctgttggtcaactaa

DBGET integrated database retrieval system