KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g224990Help
Entry
NEMVE_v1g224990   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K11252  histone H2B
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Chromosome [BR:nve03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    NEMVE_v1g224990
Exosome [BR:nve04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NEMVE_v1g224990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 5496897
NCBI-ProteinID: XP_001618584
JGI: 224990
UniProt: A8DV29
AA seq 100 aa AA seqDB search
MPPKSGKKPEASKGKKNVVAGDKKKRKGRRKESYAIYIYKVLKQVHPDTGISSKAMGIMN
SFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLLL
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctaaatctggtaagaaacccgaagcatctaaaggcaagaaaaacgtcgtagct
ggtgacaaaaagaagcgcaaaggtcgtcgcaaggagagctacgccatctacatttacaaa
gttctgaagcaagttcatcccgacacaggaatctccagcaaagcaatgggcatcatgaat
tcgttcgtgaacgatatattcgaacgcatcgctgcagagtcgtctcggctagcgcactac
aacaagaagtccacaatcagctcgcgagagattcagactgcaattcgcctactactacta
tga

DBGET integrated database retrieval system