KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g227127Help
Entry
NEMVE_v1g227127   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00905  
[3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase [EC:2.7.11.4]
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Enzymes [BR:nve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.4  [3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase
     NEMVE_v1g227127
Protein kinases [BR:nve01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [Table]
   NEMVE_v1g227127
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 376 aa AA seqDB search
MSMYGSQTQVWSHVKQNTLDEYASKSSIRLTPYQMLYAGKFKDGTHLLKSAQYLHKELPI
RIARRLKDFQQLPYIILSNPSIHDTYELYLRAFTSLTKYPKIDNLESEERFSHLVKNLLD
NHQHVVTNLAEGFQECKQHVSYETMGNFLDRTLKSRLGIRMLAEHHLALRFEKPNYIGMI
CTQLNLKQAIERSSDFARQICEHLYGVAPGVIVNGHTKAMFPYIPSPLEYILQELIKNAM
RASVEYHGKQLMEVPNIVVTTCTNDTDFYVRISDRGGGIPENKLKDIFKYSFTTMGDRSQ
IRPSDGLGVFDDICQGHPNNSPSGGPMAGWGFGLPTSRAYSTYLGGSLQVQTMEGLGTDV
YLRLRHITGNQESFRI
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgtatgggtcacagactcaagtttggagccatgttaaacaaaacactttggac
gaatacgcctcaaagtcatccattcgtttgacaccctatcagatgctatacgctggcaaa
ttcaaagatggaacccatttgttgaaaagtgctcaatacctacataaagaactgcctatc
aggattgcaagacgcttgaaggactttcagcagttaccgtacatcattctctccaacccc
tcaattcatgacacatatgagctctacctgcgagctttcacatcgctgacaaaataccca
aagattgataacctggaaagtgaagagcgcttcagtcacctcgtcaaaaacttgcttgac
aaccatcagcatgttgtcacaaatttggctgaaggtttccaagaatgcaaacagcatgtc
tcatatgagaccatgggcaattttctggaccgcaccttgaagtctagacttggaatcaga
atgcttgccgagcatcacttggcactcagatttgagaagccaaattacattggtatgatc
tgcacacaactgaacctgaaacaggccattgagagatcgtctgattttgccagacaaatt
tgtgagcatctgtacggtgttgcacctggagtaatagtgaatggtcataccaaggcaatg
ttcccatacatcccttcccccctagagtacatcttgcaggaacttatcaagaatgcgatg
agagcaagtgttgaataccatggaaaacagttgatggaagtccctaacatcgtagtgaca
acatgcaccaacgatacagacttctatgtcaggatatctgacagaggaggtggaataccc
gaaaataagctcaaagatatctttaagtactcctttaccaccatgggagaccgcagtcag
atccggccctctgacggcctgggtgtgtttgacgacatctgccaaggtcaccctaacaac
tccccaagcggcggtcccatggccgggtggggcttcggtctaccaacatctcgcgcgtat
tccacatatctgggtggctctctccaagtacagacgatggaagggttaggcactgatgtg
tacctaagattaaggcacatcacagggaaccaagagagcttccgtatttag

DBGET integrated database retrieval system