KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g227385Help
Entry
NEMVE_v1g227385   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:nve00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:nve00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:nve00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:nve00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:nve00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 463 aa AA seqDB search
MRTSVPGPKSQELFKELDEIQSSKGMKYFVDFEKSKGNYVVDADGNVMLDVYQQIASIPL
GYNHPALLKAMQDPEILSSIINRSALGLLPPKTLPKNLKESVLSVSPKGLTEVTTMACGT
CANENAIKAACIWYRNRERGSETPTEEDMITCMKGQAPGSPPYTVLSFTGGFHGRTLGSL
TLTRSKAIHKVDIPSFDWPVATFPKLKYPLEEHQRENAAEEQRCLDEVKEIISTWNKAGK
PVAALITEPIQAEGGDNHASPNFFKGLQAICKEFGTAFIVDEVQTGVGSTGKFWAHEHWG
LDEAPDFVTFSKKMAIGGFYYKHEFRPSAPFRIFNTWMGDPNKMILLREVLKVIRKDNLI
EYTADVGKELLKGLQYIEERHPEFVSRARGLGTFCGIDLPDLETRTKFLGQMRNNGVDMD
GCGVKTVRFRPALIFGHKHLDLAVNTMDSVLNGMKGSKKTASA
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaggacatctgtacctggtcccaagtcacaggaactcttcaaggaactagatgaaatc
cagtcctcaaagggaatgaagtactttgttgactttgagaagagcaaggggaattatgtt
gtggatgccgatgggaatgtcatgcttgatgtctaccaacagattgcttccattccactc
gggtacaaccacccagcactgttgaaagccatgcaagatcctgagattctgtcttccatc
atcaaccgatctgcacttggtctacttcctccaaaaactctcccaaaaaacctgaaggag
tcagtcttatcagtttcccctaaaggcctaactgaggtcacaaccatggcatgtgggaca
tgtgcaaatgagaacgccatcaaggccgcctgcatttggtacaggaatagagagaggggt
tcagaaactccgacggaagaagacatgattacttgcatgaagggacaagccccaggttct
ccaccatacacggtgttatcatttactggaggattccatggacgtacactaggctctctt
acccttacaaggtcaaaagccatccataaggttgacatcccatcatttgactggcctgtt
gcaacattccctaagttgaagtaccctcttgaagaacatcagcgtgagaatgcagcagaa
gagcagcgatgccttgatgaggtaaaagaaattatcagcacatggaacaaggcaggaaaa
cctgttgctgcactcattactgaaccaatacaagcggaaggaggtgataatcatgcatcc
ccaaatttcttcaaaggattgcaggcaatctgtaaagagtttggcactgcttttattgtt
gatgaagtgcagacaggtgtcggatcgactggtaaattttgggcacatgagcattggggc
cttgatgaggctcctgatttcgtgaccttctccaagaagatggcaatcggtggattctac
tacaaacatgagttccgtccaagtgcgccattccgcatctttaacacgtggatgggtgac
ccaaataagatgattctgctccgagaggtactcaaggtcatcagaaaggacaaccttata
gagtacacagccgacgtcggcaaggagcttctcaaggggctacagtacattgaggagcga
caccccgagtttgtgtcgagagcgcgtggcttgggaacattctgtggcattgaccttcct
gatctcgaaacgagaaccaagttcctgggccaaatgagaaacaacggtgtcgatatggac
ggctgcggcgtcaaaacagtccgattccgccccgcactcatcttcggccacaagcatctg
gacctcgccgtcaataccatggacagcgtgctgaatggcatgaagggatctaagaagacc
gcctcggcctag

DBGET integrated database retrieval system