KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g227385Help
Entry
NEMVE_v1g227385   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NEMVE_v1g227385
   00650 Butanoate metabolism
    NEMVE_v1g227385
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NEMVE_v1g227385
   00280 Valine, leucine and isoleucine degradation
    NEMVE_v1g227385
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NEMVE_v1g227385
Enzymes [BR:nve01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     NEMVE_v1g227385
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     NEMVE_v1g227385
Amino acid related enzymes [BR:nve01007]
 Aminotransferase (transaminase)
  Class III
   NEMVE_v1g227385
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 463 aa AA seqDB search
MRTSVPGPKSQELFKELDEIQSSKGMKYFVDFEKSKGNYVVDADGNVMLDVYQQIASIPL
GYNHPALLKAMQDPEILSSIINRSALGLLPPKTLPKNLKESVLSVSPKGLTEVTTMACGT
CANENAIKAACIWYRNRERGSETPTEEDMITCMKGQAPGSPPYTVLSFTGGFHGRTLGSL
TLTRSKAIHKVDIPSFDWPVATFPKLKYPLEEHQRENAAEEQRCLDEVKEIISTWNKAGK
PVAALITEPIQAEGGDNHASPNFFKGLQAICKEFGTAFIVDEVQTGVGSTGKFWAHEHWG
LDEAPDFVTFSKKMAIGGFYYKHEFRPSAPFRIFNTWMGDPNKMILLREVLKVIRKDNLI
EYTADVGKELLKGLQYIEERHPEFVSRARGLGTFCGIDLPDLETRTKFLGQMRNNGVDMD
GCGVKTVRFRPALIFGHKHLDLAVNTMDSVLNGMKGSKKTASA
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaggacatctgtacctggtcccaagtcacaggaactcttcaaggaactagatgaaatc
cagtcctcaaagggaatgaagtactttgttgactttgagaagagcaaggggaattatgtt
gtggatgccgatgggaatgtcatgcttgatgtctaccaacagattgcttccattccactc
gggtacaaccacccagcactgttgaaagccatgcaagatcctgagattctgtcttccatc
atcaaccgatctgcacttggtctacttcctccaaaaactctcccaaaaaacctgaaggag
tcagtcttatcagtttcccctaaaggcctaactgaggtcacaaccatggcatgtgggaca
tgtgcaaatgagaacgccatcaaggccgcctgcatttggtacaggaatagagagaggggt
tcagaaactccgacggaagaagacatgattacttgcatgaagggacaagccccaggttct
ccaccatacacggtgttatcatttactggaggattccatggacgtacactaggctctctt
acccttacaaggtcaaaagccatccataaggttgacatcccatcatttgactggcctgtt
gcaacattccctaagttgaagtaccctcttgaagaacatcagcgtgagaatgcagcagaa
gagcagcgatgccttgatgaggtaaaagaaattatcagcacatggaacaaggcaggaaaa
cctgttgctgcactcattactgaaccaatacaagcggaaggaggtgataatcatgcatcc
ccaaatttcttcaaaggattgcaggcaatctgtaaagagtttggcactgcttttattgtt
gatgaagtgcagacaggtgtcggatcgactggtaaattttgggcacatgagcattggggc
cttgatgaggctcctgatttcgtgaccttctccaagaagatggcaatcggtggattctac
tacaaacatgagttccgtccaagtgcgccattccgcatctttaacacgtggatgggtgac
ccaaataagatgattctgctccgagaggtactcaaggtcatcagaaaggacaaccttata
gagtacacagccgacgtcggcaaggagcttctcaaggggctacagtacattgaggagcga
caccccgagtttgtgtcgagagcgcgtggcttgggaacattctgtggcattgaccttcct
gatctcgaaacgagaaccaagttcctgggccaaatgagaaacaacggtgtcgatatggac
ggctgcggcgtcaaaacagtccgattccgccccgcactcatcttcggccacaagcatctg
gacctcgccgtcaataccatggacagcgtgctgaatggcatgaagggatctaagaagacc
gcctcggcctag

DBGET integrated database retrieval system