KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g227398Help
Entry
NEMVE_v1g227398   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:nve01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nve00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:nve00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:nve00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 416 aa AA seqDB search
MEAGTLVSWEKQEGDELAEGDLLAQIETDKATMEFETPEEGFIAKILIPAGSKDVPIGKL
LCIIVPNKEDVDKFKNFTVDDAEGAAESPPPPPPTKAAAPPTPPAASPPQPATPTPPAAA
AAPFAGGRVMASPLAKKMAQDQGVSLSGIPGSGPGGRITAADVQTAASAALAAQPTPVAA
APIPGTVYEDIPLSNMRQVIAKRLLQSKQTIPHYYLSVDVKMDQLIEIRKQLNEQGKGSY
KLSINDFIVKSCALACRQVPEANSSWMGDFIRRYENVDVSVAVSTDNGLITPIVFDADKK
GLSSISGDITSLAEKARAGKLQPQEFQGGTITISNLGMFGIKNFAAVINPPQACILAVGG
TEKRVLADETSEKGYSVGNVMSVTLSCDHRVVDGAVGAQWLAVFKKYLENPMTMLL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggggacgctcgtgagttgggagaagcaggaaggggatgagctggcagagggc
gacttgcttgcacagatagagacagataaggcgacaatggagtttgagactcctgaagaa
ggcttcattgccaagattttgatccctgctggctcaaaagatgtccctatcggcaagcta
ttgtgcattattgtgccaaataaggaggacgtggacaagttcaagaactttactgtggat
gacgcagagggtgccgctgagtctcctccccctcctcctcctaccaaagcagctgcacct
cccacccctccagcagcatctccaccccaaccagccacgcccacaccccctgcagcggct
gctgcaccttttgcaggtgggagggtaatggcaagccccctagcaaagaagatggcccaa
gatcaaggagtcagcttgtctggcattcctggatctggtcctggtggtagaataactgca
gccgatgtgcagacagctgcctcagctgcccttgctgcacagccaacccctgtggctgca
gctcctatcccaggtactgtatatgaggacattccactgtctaacatgcgacaagtgata
gctaaacgactgctgcagtccaaacagaccatcccccattactatctgtctgtggacgtc
aagatggatcaactcattgagatccgtaaacagttaaatgagcaaggcaagggatcctac
aagctatcaatcaatgactttattgtcaagtcgtgtgccctggcttgcagacaggtccct
gaggccaactcatcgtggatgggagactttataagaaggtatgaaaatgtagatgtttct
gttgccgtcagtactgacaatggtctgatcactcccattgttttcgatgctgataaaaag
ggactgtcttcaataagtggtgatataacttcacttgctgaaaaggcaagggctggcaag
ctacagccgcaggagttccagggcggtacaatcaccatctctaatcttggcatgtttgga
ataaaaaactttgctgcagttataaatcctccccaggcatgtatccttgcggtgggtgga
acagagaagagagtccttgcggatgaaaccagtgaaaagggatacagtgtcggtaatgtg
atgtctgtcaccctaagctgtgaccaccgtgttgtcgacggtgctgtaggtgcacagtgg
ttggcagtttttaagaagtacctggaaaacccgatgaccatgttgctatag

DBGET integrated database retrieval system