KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g228101Help
Entry
NEMVE_v1g228101   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:nve01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:nve00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:nve00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 192 aa AA seqDB search
MEMRQTYKDAFFKKHGLKLGFMSAFVKAAAYALESLPVVNAVIEDNQIVYRDYVDISVAV
STPKGLVVPVLRNVESMNFADIEKAINALGEKARNNDLAIEDMDGGTFTISNGGVFGSLM
GTPIINPPQSAILGMHAINERPVAINGKIEIRPMMYVALTYDHRLIDGREAVTFLRKVKS
VVEDPRVLMLDL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggagatgcgtcagacatacaaagacgccttctttaagaagcatggtctcaaacttggc
ttcatgtcagcattcgtgaaggcagcagcttatgctctggagagcttacctgttgtaaac
gcagtgattgaggataaccagatagtgtacagggattatgtcgacatcagtgttgctgta
tccacaccaaagggcctagttgttcctgttctgcgcaatgttgagtccatgaactttgcc
gatatagagaaagcaatcaacgctttaggagaaaaggctcgtaacaatgacctagctatt
gaggacatggatggcggcaccttcaccatctctaatggcggagtatttggctccctcatg
ggcacacccatcatcaacccgccgcagtctgccatcctaggcatgcatgccattaatgag
agaccagtagctatcaacggcaagatagagatccgacccatgatgtatgtcgccctcaca
tacgaccatcgcctgattgacggcagagaagcggtcaccttcctacgtaaggtcaagtct
gtggtcgaagacccacgagttctcatgctggacttataa

DBGET integrated database retrieval system