KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g228101Help
Entry
NEMVE_v1g228101   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NEMVE_v1g228101
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NEMVE_v1g228101
  Amino acid metabolism
   00310 Lysine degradation
    NEMVE_v1g228101
Enzymes [BR:nve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NEMVE_v1g228101
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 192 aa AA seqDB search
MEMRQTYKDAFFKKHGLKLGFMSAFVKAAAYALESLPVVNAVIEDNQIVYRDYVDISVAV
STPKGLVVPVLRNVESMNFADIEKAINALGEKARNNDLAIEDMDGGTFTISNGGVFGSLM
GTPIINPPQSAILGMHAINERPVAINGKIEIRPMMYVALTYDHRLIDGREAVTFLRKVKS
VVEDPRVLMLDL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggagatgcgtcagacatacaaagacgccttctttaagaagcatggtctcaaacttggc
ttcatgtcagcattcgtgaaggcagcagcttatgctctggagagcttacctgttgtaaac
gcagtgattgaggataaccagatagtgtacagggattatgtcgacatcagtgttgctgta
tccacaccaaagggcctagttgttcctgttctgcgcaatgttgagtccatgaactttgcc
gatatagagaaagcaatcaacgctttaggagaaaaggctcgtaacaatgacctagctatt
gaggacatggatggcggcaccttcaccatctctaatggcggagtatttggctccctcatg
ggcacacccatcatcaacccgccgcagtctgccatcctaggcatgcatgccattaatgag
agaccagtagctatcaacggcaagatagagatccgacccatgatgtatgtcgccctcaca
tacgaccatcgcctgattgacggcagagaagcggtcaccttcctacgtaaggtcaagtct
gtggtcgaagacccacgagttctcatgctggacttataa

DBGET integrated database retrieval system