KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g228495Help
Entry
NEMVE_v1g228495   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
nve  Nematostella vectensis (sea anemone)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 123 aa AA seqDB search
MPPKTPVGKSAGKKAVKKQVGEGKKKRKSRRKESYAIYIYKVLKQVHPDTGISSKAMVIM
NSFVHDIFERIAGEASRLAHYNKKSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgccgccaaaaaccccagtcggaaaatccgcaggcaaaaaggccgtcaagaagcaggtt
ggagagggcaagaagaagagaaagtcaagacgtaaggaaagctatgctatctacatctac
aaggtgctgaagcaagtccaccccgacaccggtatctcgagcaaggccatggtcatcatg
aactcgttcgtgcacgacatcttcgagcgcatcgctggtgaagcttcccgcctggcgcac
tacaacaagaagtccaccatcacgagcagggaaatccagacggccgttcgtctgcttctc
cccggtgagctggccaagcacgccgtgagcgagggaaccaaggccgtcaccaagtacacc
agcagcaagtaa

DBGET integrated database retrieval system