KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g229384Help
Entry
NEMVE_v1g229384   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:nve00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:nve00051]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 399 aa AA seqDB search
MEEWCRFSVCYWHTFRGTGADPFGFPTLTRPWDDGSNSLENAKRRLRAAFEFFTKLGVKY
WTFHDRDVAPEGETLAETNANLDEITDLALQLQNETGVKLLWATCNLFANPRYMNGAASN
PDAHVLAYAAAQVKKGLEIAKKLGAVNFVFWGGREGYHTLLNTDIKRELDHMASFFKMVV
AYKEKIGFTGQLLIEPKPKEPTRHQYDYDAQTVIGFLKTYGLDHHFKLNIEPNHTTLAGH
SYEHDIVLASKVGMLGSIDANTGSPDLGWDTDQFPMNVKNCMFIMKAIIEQGGLAPGGLN
FDCKVRRESTDIEDMFISHIGAMDTLARALRCAATLIEEGKMSGLVKERYSSFDSGIGSK
IEKGLATLEELENFVMANGEPQLLSGKQEKYESILNHYV
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggaggaatggtgtcgcttttctgtgtgctactggcatacatttagaggaacaggtgca
gatccatttggtttcccaaccttgacccgaccttgggatgatggctctaacagcttggaa
aatgccaagaggaggctgagagcagcttttgaattctttacaaaacttggagtgaagtac
tggacttttcatgacagagatgttgctccagagggggaaacccttgctgagactaatgcc
aatctggacgagatcacagatcttgccttacagcttcaaaatgagacaggtgtgaagtta
ctttgggcaacatgcaacctctttgccaacccaagatacatgaatggagcagcaagtaat
cctgatgctcatgtgttggcatatgctgcggcccaagtgaagaaaggcttagaaattgcc
aagaagctcggagctgttaattttgtgttctggggtggcagagagggataccacactcta
ctcaacacagatatcaagagagagctggaccacatggcaagcttctttaagatggttgtg
gcttacaaagagaagataggatttaccggccagctgttgattgagccaaagcctaaagaa
ccaacgagacaccagtatgactatgatgcccaaactgttattggatttttgaagacatac
ggactggaccaccatttcaagttgaatatcgagccaaaccacacaaccttggctggacac
agctatgagcatgacattgtcctagcatccaaggtgggtatgctgggctcaattgacgca
aacacaggatctccagatctgggatgggacactgaccaattccctatgaatgtcaagaat
tgcatgttcatcatgaaggctatcattgagcagggggggctcgcacctggagggcttaac
tttgattgcaaggtccgccgggaatccacagacatagaggatatgttcatatcacacata
ggtgccatggatactttagcacgagcgttgagatgcgctgctacgttgattgaagagggg
aaaatgtcaggacttgtcaaggagaggtattcaagcttcgactctggcattggctctaaa
atcgagaaaggacttgctacacttgaagagctcgagaacttcgtaatggcgaatggtgag
ccgcagcttttgtccggaaaacaagagaaatacgaatccattctgaatcactatgtttaa

DBGET integrated database retrieval system