KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g229921Help
Entry
NEMVE_v1g229921   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Steroid biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    NEMVE_v1g229921
Enzymes [BR:nve01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     NEMVE_v1g229921
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 398 aa AA seqDB search
MGEVLISHIQEGTLLSYVWGNIPEVTLSGVGLFLTWLTLQLVLYLALPGRIATGNPTPAG
NILSYKCNGLNAWIFTHALFIALAYFDLMKMTVIYNYWGSLLVLANILGILLTAFVYVKA
HYFPTHKEDRCFSGSFFYDFYMGIEANPRIGNLDFKLFFNGRPGIVAWTLINLSMAARQY
EQLGYVTNSMLLVNILQGMYVVDFFAHEAWYLRTIDIAHDHFGFYLAWGDCVWLPFMYTL
QAVYLVYHPVRLSWIASFVILALGISGYLIFRLVNSQKDYFRCQMKRTGSCEIWGEPAKY
VTAEYTTSDGEVKTSWLLSSGWWGLSRHFNYVGDLMGCLAYCAACGTGHVLPYFYLIYMT
VLLVHRSYRDDVRCREKYGKYWAEYTKLVPYRIVPYLF
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgggagaagttttgatatcccacatacaagaggggacactgctaagttacgtctgggga
aacataccggaagtgacgttatctggtgttgggctctttctaacgtggctaacgctacag
ctggttctctacctagctcttcccgggcgaatagccacaggtaacccgactccagctggg
aacattttgtcttacaagtgcaacggtttgaacgcttggatttttacgcatgcgctgttc
atcgcgcttgcgtactttgacctcatgaagatgacggtgatttacaactactggggatct
ctactggtcctcgctaacatcctgggaatactgctgaccgcctttgtgtatgtaaaggct
cactacttccccactcacaaggaagaccgctgcttcagcggctcattcttctacgacttc
tacatgggcatcgaggctaacccacgcattggaaacctggactttaaattgttcttcaac
ggtaggccaggaatcgtggcttggaccctgatcaacctcagcatggcggcgaggcaatac
gagcagcttggatacgtcaccaactctatgttacttgtcaacatccttcagggcatgtac
gtcgtcgacttctttgcgcacgaggcctggtacctaaggaccatcgacattgcgcatgac
cactttggattctacctggcctggggcgactgcgtgtggctgccattcatgtacacgttg
caggcggtctacctggtataccaccctgtacgcctcagctggattgccagttttgtgatc
ttggctctcggcatttccggttaccttatcttccgtctagtcaactcccagaaggattac
ttccggtgtcagatgaagcgcacaggcagctgtgaaatctggggcgagcccgcaaaatac
gtgactgcagagtacaccacctcggatggcgaagtgaagacgtcctggcttttatcttcc
ggttggtgggggctttcccgccatttcaactacgtaggagatctgatgggctgtcttgca
tattgcgccgcatgtggtactggtcacgtgcttccgtacttctacctcatttacatgacc
gtgttgctggtgcaccgttcgtaccgtgatgacgtcagatgcagggagaagtacgggaag
tactgggccgagtacaccaagcttgtgccgtatagaatagtcccgtatctcttctag

DBGET integrated database retrieval system