KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g229971Help
Entry
NEMVE_v1g229971   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00010  Glycolysis / Gluconeogenesis
nve00052  Galactose metabolism
nve01100  Metabolic pathways
Module
nve_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NEMVE_v1g229971
   00052 Galactose metabolism
    NEMVE_v1g229971
Enzymes [BR:nve01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     NEMVE_v1g229971
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim FERM_N
Motif
Other DBs
NCBI-GeneID: 5509733
NCBI-ProteinID: XP_001630193
JGI: 229971
UniProt: A7SDT3
AA seq 345 aa AA seqDB search
MASAKIEKSLYGQTKAGKDVYKYTFTNMNGVQVEVISFGAIIIAVKTPDRNGTFEDITLG
YDDIKGFEDNPPYFGSTIGRVANRIANAEFTLDGKTYHLAKNNGPNCLHGGLIGFNKVLW
QSSIEEDHVKMSYTSHDGEEGFPGKVKVTVTYSLTEDNEIRINYSATTSKATPINLTNHS
YFNLAGQVAKDVLSHVMWIDADKYLPTNKVQIPTGEFRPVTGEPEGAFDFTKPKAIGKDI
DKTPPGYDHCFCLNQGEGMKARVVHPESGRVLQIFTNQPGMQLYTGNFLEGNTGKAGLHY
HKHDGLALEAQDYPNAINEPSFPNTVLRPGMEYKRHIIFQFLVEK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgccaagattgaaaagagtttgtacgggcagacaaaagccggcaaagacgtc
tacaagtacacatttacgaacatgaatggagtacaagtagaagtgatatcctttggagcg
atcataattgctgtcaagactcctgatagaaatggcacctttgaagacatcacgctggga
tatgatgacatcaaaggctttgaagacaatccaccatacttcggtagtacaattgggcgt
gtcgccaatagaattgcaaatgctgagtttacacttgatggtaaaacataccatcttgct
aagaataatggtccaaactgtcttcatggcggcctcataggcttcaacaaggttttgtgg
cagagcagtatagaagaagatcatgttaagatgagttacacaagccatgatggagaagag
ggtttccctggaaaagtcaaagtcactgttacgtacagtctaacagaagataatgaaatc
agaatcaactacagtgcgacgacaagtaaagctacacctatcaatctcaccaaccactcc
tacttcaacttagcaggacaggttgctaaggacgtcctaagtcatgtgatgtggattgat
gctgacaagtatctaccaactaataaagtgcagatacccacaggggagtttcgaccagta
acaggagaaccagaaggtgcatttgacttcactaaacccaaagcaatagggaaagacatt
gacaaaactcccccaggatatgatcactgtttctgtctcaatcaaggagaaggcatgaaa
gcaagggttgtccatcctgaaagtggcagagtactgcaaatattcaccaatcagccagga
atgcagctgtacacagggaacttccttgaggggaacacaggaaaagcagggcttcattac
cacaaacatgatggcttggctcttgaagctcaggactacccaaatgctatcaatgagcca
tcttttcctaacacggtactccgccctggaatggaatacaagcgtcacatcatcttccag
tttttggtggagaaataa

DBGET integrated database retrieval system