KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g229971Help
Entry
NEMVE_v1g229971   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nve00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:nve00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 345 aa AA seqDB search
MASAKIEKSLYGQTKAGKDVYKYTFTNMNGVQVEVISFGAIIIAVKTPDRNGTFEDITLG
YDDIKGFEDNPPYFGSTIGRVANRIANAEFTLDGKTYHLAKNNGPNCLHGGLIGFNKVLW
QSSIEEDHVKMSYTSHDGEEGFPGKVKVTVTYSLTEDNEIRINYSATTSKATPINLTNHS
YFNLAGQVAKDVLSHVMWIDADKYLPTNKVQIPTGEFRPVTGEPEGAFDFTKPKAIGKDI
DKTPPGYDHCFCLNQGEGMKARVVHPESGRVLQIFTNQPGMQLYTGNFLEGNTGKAGLHY
HKHDGLALEAQDYPNAINEPSFPNTVLRPGMEYKRHIIFQFLVEK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgccaagattgaaaagagtttgtacgggcagacaaaagccggcaaagacgtc
tacaagtacacatttacgaacatgaatggagtacaagtagaagtgatatcctttggagcg
atcataattgctgtcaagactcctgatagaaatggcacctttgaagacatcacgctggga
tatgatgacatcaaaggctttgaagacaatccaccatacttcggtagtacaattgggcgt
gtcgccaatagaattgcaaatgctgagtttacacttgatggtaaaacataccatcttgct
aagaataatggtccaaactgtcttcatggcggcctcataggcttcaacaaggttttgtgg
cagagcagtatagaagaagatcatgttaagatgagttacacaagccatgatggagaagag
ggtttccctggaaaagtcaaagtcactgttacgtacagtctaacagaagataatgaaatc
agaatcaactacagtgcgacgacaagtaaagctacacctatcaatctcaccaaccactcc
tacttcaacttagcaggacaggttgctaaggacgtcctaagtcatgtgatgtggattgat
gctgacaagtatctaccaactaataaagtgcagatacccacaggggagtttcgaccagta
acaggagaaccagaaggtgcatttgacttcactaaacccaaagcaatagggaaagacatt
gacaaaactcccccaggatatgatcactgtttctgtctcaatcaaggagaaggcatgaaa
gcaagggttgtccatcctgaaagtggcagagtactgcaaatattcaccaatcagccagga
atgcagctgtacacagggaacttccttgaggggaacacaggaaaagcagggcttcattac
cacaaacatgatggcttggctcttgaagctcaggactacccaaatgctatcaatgagcca
tcttttcctaacacggtactccgccctggaatggaatacaagcgtcacatcatcttccag
tttttggtggagaaataa

DBGET integrated database retrieval system