KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g230389Help
Entry
NEMVE_v1g230389   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K11252  histone H2B
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Chromosome and associated proteins [BR:nve03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    NEMVE_v1g230389
Exosome [BR:nve04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NEMVE_v1g230389
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone TFIID_20kDa CBFD_NFYB_HMF
Motif
Other DBs
NCBI-GeneID: 5507269
NCBI-ProteinID: XP_001627920
JGI: 230389
UniProt: A7SK99
AA seq 67 aa AA seqDB search
MGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLLPGELAKHAVSEGTKAV
TKYTSSK
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcatgaattcgttcgtgaacgatatattcgaacgcattgctgcagagtcgtct
cgactagcgcactacaacaagaagtccacaatcagctcgcgagagattcagactgcaatt
cgcctactactaccaggagagcttgccaaacacgccgtcagcgaggggaccaaagccgtt
actaagtacaccagcagcaagtga

DBGET integrated database retrieval system