KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g230469Help
Entry
NEMVE_v1g230469   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
nve  Nematostella vectensis (sea anemone)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 314 aa AA seqDB search
MAKIPSNTHQTTVSSFNPSITKHMKGSKGGPFKLLENMKQGKWNLSDFDIGKPLGKGKFG
NVYLAREKKSKYIVALKVLFKSQLQKSNVEHQLRREIEIQSHLRHNNILRLFGYFYDDTR
VYLILEYAPRGELYKELTACEKFDEKRAAKYIRQLADALAYCHSKKVIHRDIKPENLLLN
YKGDIKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGKEHDEKVDLWSIGVLCYEFLVG
KPPFEAEGHNETYRRISRVDLRFPSHVSPGARDLISKLLQHNPNNRLPLKAVLNHPWIRM
HATPVLEQKPASQR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaatcccctcaaacactcatcaaacaacagtatcttccttcaacccttctatt
accaaacacatgaagggatctaaaggtgggccattcaaattgcttgaaaatatgaagcag
gggaagtggaatctatcagattttgacattggaaagcctctcggaaaaggaaaatttgga
aatgtttacttggcacgggaaaagaaaagcaaatatattgtagccctgaaggttttattt
aaaagccagttacagaaatccaatgtggagcaccaacttagaagggaaattgagattcag
tctcatctgaggcacaacaatatcctacgcctgtttgggtatttctatgacgacacacga
gtctatcttattcttgaatatgctccccgaggagaactgtataaagaacttactgcttgt
gagaagtttgatgagaaaagagcagctaagtatattcgacagcttgcagatgctcttgct
tattgtcactctaagaaagtcatccacagagacatcaagcccgaaaaccttctcctgaat
tataagggtgatatcaagattgcagattttggttggtctgttcatgcaccatcatcacga
cgtacgactctctgtgggaccttagactatctgccacccgagatgattgaaggaaaggaa
catgatgaaaaagtcgacctttggagcataggtgtcctctgctatgaattccttgttggc
aaaccaccttttgaggcagaggggcacaatgagacatacaggagaatttcgagagttgat
ctaaggttcccatcacatgtcagtcctggagctcgtgacctgataagcaagcttctacag
cacaatcccaacaacagacttccactgaaagctgtgcttaaccacccatggatacgaatg
catgccacacctgtcctagaacaaaaaccagccagccaaagatga

DBGET integrated database retrieval system