KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g230469Help
Entry
NEMVE_v1g230469   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Enzymes [BR:nve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     NEMVE_v1g230469
Protein kinases [BR:nve01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   NEMVE_v1g230469
Protein phosphatases and associated proteins [BR:nve01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     NEMVE_v1g230469
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 314 aa AA seqDB search
MAKIPSNTHQTTVSSFNPSITKHMKGSKGGPFKLLENMKQGKWNLSDFDIGKPLGKGKFG
NVYLAREKKSKYIVALKVLFKSQLQKSNVEHQLRREIEIQSHLRHNNILRLFGYFYDDTR
VYLILEYAPRGELYKELTACEKFDEKRAAKYIRQLADALAYCHSKKVIHRDIKPENLLLN
YKGDIKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGKEHDEKVDLWSIGVLCYEFLVG
KPPFEAEGHNETYRRISRVDLRFPSHVSPGARDLISKLLQHNPNNRLPLKAVLNHPWIRM
HATPVLEQKPASQR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaatcccctcaaacactcatcaaacaacagtatcttccttcaacccttctatt
accaaacacatgaagggatctaaaggtgggccattcaaattgcttgaaaatatgaagcag
gggaagtggaatctatcagattttgacattggaaagcctctcggaaaaggaaaatttgga
aatgtttacttggcacgggaaaagaaaagcaaatatattgtagccctgaaggttttattt
aaaagccagttacagaaatccaatgtggagcaccaacttagaagggaaattgagattcag
tctcatctgaggcacaacaatatcctacgcctgtttgggtatttctatgacgacacacga
gtctatcttattcttgaatatgctccccgaggagaactgtataaagaacttactgcttgt
gagaagtttgatgagaaaagagcagctaagtatattcgacagcttgcagatgctcttgct
tattgtcactctaagaaagtcatccacagagacatcaagcccgaaaaccttctcctgaat
tataagggtgatatcaagattgcagattttggttggtctgttcatgcaccatcatcacga
cgtacgactctctgtgggaccttagactatctgccacccgagatgattgaaggaaaggaa
catgatgaaaaagtcgacctttggagcataggtgtcctctgctatgaattccttgttggc
aaaccaccttttgaggcagaggggcacaatgagacatacaggagaatttcgagagttgat
ctaaggttcccatcacatgtcagtcctggagctcgtgacctgataagcaagcttctacag
cacaatcccaacaacagacttccactgaaagctgtgcttaaccacccatggatacgaatg
catgccacacctgtcctagaacaaaaaccagccagccaaagatga

DBGET integrated database retrieval system