KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g232588Help
Entry
NEMVE_v1g232588   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
nve  Nematostella vectensis (sea anemone)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 420 aa AA seqDB search
MRISRALLRDISKLIQRYSRYQQSCLSIEQYTTFGKNAKPVDSYRFGKHELPVRLAHIIR
EIDLLPKNLLRMPSVELVRSWYVQSFSELLEFEDDDGEEANRFTETLAHIKQRHNNVVET
MAQGIMELRQKEGLSAFHPSIQYFLDRFYMNRIGIRILITQHLMLFGHEAARSSKSNFVG
CFDPNCHVASIVEDAANNARFLCDQYYCSSPELVVSEHNAYESISHIKFAYLPAHLYHML
FELLKNAMRAVTENYSTSVDMPPIQVMITKGREDLTIKISDKGGGIPRSKIDEVFEYHYS
TAPEPSTSGTVAPLAGYGYGLPLSRLYAKYFDGDLQLYSMEGYGTDAVIWLKALSTDASE
VLPMYNRRTPKNYEEVRASANYASDWSSSRFYGRPGTHRFISTYNTRRTIGENCPRKKAL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaggatttcacgggcgttattacgagatatcagcaaactaatccagcgttatagccgt
taccagcaatcgtgcttgtccattgaacaatacactacatttggtaaaaatgccaagcca
gttgattcctacagatttggaaagcatgagttacctgtgcgtcttgcacacatcatcaga
gagattgacttactccccaagaatctactgcgaatgccatctgttgaattagttagaagc
tggtatgtccagagtttttcagagttattagaatttgaagatgatgatggagaagaagcc
aacagatttactgagacgttggctcatatcaaacagagacataacaatgtagtagagacc
atggcacagggaataatggaactaaggcaaaaggaaggattgtctgcatttcatccctct
attcaatacttcttggatcgtttttacatgaacagaattggaataaggattttgatcacc
cagcacttgatgctgtttggccacgaggcagctagaagctccaagagtaactttgtgggc
tgttttgatcccaactgtcatgttgcctcaatagtagaagatgcagctaataatgcaaga
ttcctgtgtgaccagtactattgttcttcacctgagcttgtggtcagcgaacataatgcc
tacgagtcgataagccatatcaagtttgcctacctgccagctcacctatatcacatgcta
tttgaactgctaaagaatgcaatgagagcagtcacagaaaactactcgaccagcgtggat
atgcctcctattcaagttatgataaccaaaggcagggaagatcttaccattaagatatca
gacaagggtggaggcatccctcgtagcaagatagatgaggtctttgaatatcactattcc
acagctcctgagccatccacatctgggactgtcgccccactggctgggtatggttatggt
ttgcccctctctagactctatgcaaagtatttcgatggagatctgcagttgtattcaatg
gaaggatatggaacagatgctgttatatggctcaaggctctgtcaacagatgcaagtgaa
gtattacccatgtataaccgaaggaccccaaagaactatgaggaagtaagggcatctgct
aactacgcaagtgactggagttcctcaaggttctatggccggccaggcactcacagattt
atttccacatacaacacaagaagaactattggtgaaaactgtccgagaaaaaaagcactt
taa

DBGET integrated database retrieval system