KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g233772Help
Entry
NEMVE_v1g233772   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:nve00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    NEMVE_v1g233772
   04068 FoxO signaling pathway
    NEMVE_v1g233772
Enzymes [BR:nve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     NEMVE_v1g233772
Protein kinases [BR:nve01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   NEMVE_v1g233772
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 428 aa AA seqDB search
MALCKGRIASGFMALPTTHSQRTPVFHSRHYAPQMQQQNHPDRPIGYGAFGVVWSVTDPR
NGKRVALKKMPKVFQNITSSRRAYRELRMLCTLKHDNVISAIDIVHPGHIDLFHEIYVVS
ELMQSDLHKIIVSPQPLTADHVKVFLYQILRGLKYLDSAKILHRDIKPGNLLVNSNCLLK
ICDFGLARLEEPDESVIMTQEVVTQYYRSPELLTGSTHYTQAVDIWSVGCIFAELLSRKI
LFQAQSPVQQLNQIIDLLGTPCLEDLSKAGSSEGATKYILQRPHKPPALASLYNLSNQAT
HEAVHLLCRMLVFNPNKRISCIDALSHPYLDEGRLRFHTCMCKCCQTTPAGRQYVSDFEP
VNPARFDDSYEYNLNDISSIKESLYKYVLEHQGNSVPLCINMASPSFKSFQRSGVAPQPD
KMESPQLC
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggctttgtgtaagggtcgcatcgctagtgggttcatggctcttcctaccactcactcc
caaagaacgcctgtctttcacagccgacattatgctccacaaatgcaacagcaaaaccac
cccgacagacctatcggctatggagctttcggagttgtttggtcagtgacagaccccagg
aatgggaagagagttgcactcaagaaaatgccgaaagtatttcagaatataacatcttct
agaagagcttacagggaactacgaatgctatgtaccctaaaacacgataatgttatttct
gctatagatatagttcacccaggacacatcgacttgtttcacgaaatctatgtagtatca
gagcttatgcagtcagacttgcataagatcatcgtctcaccacaacccctaacagcagac
catgtcaaagtatttctgtaccaaatcttacgaggtcttaagtatttagattcagcaaaa
atccttcatcgggacattaaacctgggaatttattagtcaacagcaattgtcttttaaag
atttgtgattttggtttagcacgtttggaggagccagatgagagtgtcattatgacgcaa
gaggttgtaactcagtattacagatcacctgagctgctaacaggctcaacacactacaca
caagcagttgacatctggtcagtgggatgtatcttcgctgaacttttgagtaggaagatt
ctgtttcaagcgcaaagcccagtgcaacagttaaatcagattattgacttattgggaaca
ccatgcttagaagatctttcaaaggcaggctccagtgaaggtgctaccaagtatatattg
cagagaccccacaagcctccagcactggcctcactttacaacctgtccaaccaagcaact
catgaagcagttcacctgctttgcagaatgctagtattcaaccctaacaaaaggatctct
tgcattgacgccttgtcccacccttacttggatgaaggccgactacgcttccatacttgt
atgtgcaagtgttgccagacaactcctgctggccggcaatatgtctcagactttgaacct
gtaaaccctgcaagatttgatgatagttatgaatataatttgaatgatatatcttcaata
aaagaatctctctataagtatgtgcttgaacaccaggggaactcggttcccctttgcatc
aatatggcctcaccatccttcaagagcttccagagatctggtgttgcacctcaaccagat
aaaatggagtctccccaactttgctag

DBGET integrated database retrieval system